SNX14 Antibody

Images

 
Western Blot: SNX14 Antibody [NBP1-80838] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: SNX14 Antibody [NBP1-80838] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: SNX14 Antibody [NBP1-80838] - Analysis in human cell line THP-1.
Immunohistochemistry-Paraffin: SNX14 Antibody [NBP1-80838] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: SNX14 Antibody [NBP1-80838] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: SNX14 Antibody [NBP1-80838] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNX14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LFRFMNFLKQEGAVHVLQFCLTVEEFNDRILRPELSNDEMLSLHEELQKIYKTYCLDESIDKIRFDPFIVEEIQRIAEGPYIDVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRGAESPTRN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNX14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
WB, ICC/IF reported in scientific literature (PMID: 24859318). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SNX14 Protein (NBP1-80838PEP)
Publications
Read Publication using
NBP1-80838 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNX14 Antibody

  • MGC13217
  • RGS-PX2
  • sorting nexin 14
  • sorting nexin-14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88878
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-56398
Species: Hu
Applications: WB, ICC/IF
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-03492
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-21369
Species: Hu
Applications: WB, IP
NBP3-09892
Species: Hu
Applications: WB
NBP2-94213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-33686
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP1-80838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SNX14 Antibody (NBP1-80838)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for SNX14 Antibody (NBP1-80838) (0)

There are no reviews for SNX14 Antibody (NBP1-80838). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SNX14 Antibody (NBP1-80838) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SNX14 Products

Bioinformatics Tool for SNX14 Antibody (NBP1-80838)

Discover related pathways, diseases and genes to SNX14 Antibody (NBP1-80838). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX14 Antibody (NBP1-80838)

Discover more about diseases related to SNX14 Antibody (NBP1-80838).

Research Areas for SNX14 Antibody (NBP1-80838)

Find related products by research area.

Blogs on SNX14

There are no specific blogs for SNX14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNX14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX14
Entrez