Recombinant Human Wee1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Wee1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 289-388 of Human WEE1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SNMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAI

Protein/Peptide Type
Partial Recombinant Protein
Gene
WEE1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Wee1 Protein

  • DKFZp686I18166
  • EC 2.7.10.2
  • FLJ16446
  • WEE1 homolog (S. pombe)
  • wee1+ (S. pombe) homolog
  • WEE1+ homolog
  • Wee1A kinase
  • WEE1A
  • WEE1hu
  • wee1-like protein kinase

Background

WEE1 - WEE1 homolog (S. pombe)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02275
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-81021
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP

Publications for Wee1 Partial Recombinant Protein (H00007465-Q01) (0)

There are no publications for Wee1 Partial Recombinant Protein (H00007465-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Wee1 Partial Recombinant Protein (H00007465-Q01) (0)

There are no reviews for Wee1 Partial Recombinant Protein (H00007465-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Wee1 Partial Recombinant Protein (H00007465-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Wee1 Products

Bioinformatics Tool for Wee1 Partial Recombinant Protein (H00007465-Q01)

Discover related pathways, diseases and genes to Wee1 Partial Recombinant Protein (H00007465-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wee1 Partial Recombinant Protein (H00007465-Q01)

Discover more about diseases related to Wee1 Partial Recombinant Protein (H00007465-Q01).
 

Pathways for Wee1 Partial Recombinant Protein (H00007465-Q01)

View related products by pathway.

PTMs for Wee1 Partial Recombinant Protein (H00007465-Q01)

Learn more about PTMs related to Wee1 Partial Recombinant Protein (H00007465-Q01).
 

Research Areas for Wee1 Partial Recombinant Protein (H00007465-Q01)

Find related products by research area.

Blogs on Wee1.

Funny Protein Names Infographic
This is not a joke, these proteins with funny names actually do exist. View our list of six proteins with funny and unusual names including: Bambi, Yippee-like 3, Wee1, SPAM1, SPOCK1 and Bagpipe homeobox protein homolog 1. Learn more about their fu...  Read full blog post.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104
Wee1 Antibody
NBP1-33506

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Wee1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WEE1