WDR5 Antibody (3S6R9)

Western Blot: WDR5 Antibody (3S6R9) [NBP3-16162] - Western blot analysis of extracts of various cell lines, using WDR5 Rabbit mAb (NBP3-16162) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Rt
• Applications: WB
• Clone: 3S6R9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

WDR5 Antibody (3S6R9) Summary

• Description: Novus Biologicals Rabbit WDR5 Antibody (3S6R9) (NBP3-16162) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 235-334 of human WDR5 (NP_060058.1). DNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: WDR5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for WDR5 Antibody (3S6R9)

• BIG3
• BIG-3
• BMP2-induced 3-kb gene protein
• SWD3
• SWD3, Set1c WD40 repeat protein, homolog
• WD repeat domain 5
• WD repeat-containing protein 5
• WDR5
• WD-repeat protein 5

Background

WDR5 encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WDR5