WDR18 Antibody


Western Blot: WDR18 Antibody [NBP2-30528] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry: WDR18 Antibody [NBP2-30528] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

WDR18 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: AEHHMFCGGSEGSIFQVDLFTWPGQRERSFHPEQDAGKVFKGHRNQVTCLSVSTDGSVLLSGSHDETVRLWDVQSKQCIR
Specificity of human WDR18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WDR18 Protein (NBP2-30528PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for WDR18 Antibody

  • MGC2436
  • R32184_1
  • WD repeat domain 18
  • WD repeat-containing protein 18


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu, Rt
Applications: WB, IHC, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Species: Hu, Mk
Applications: ICC/IF, IHC, IHC-P

Publications for WDR18 Antibody (NBP2-30528) (0)

There are no publications for WDR18 Antibody (NBP2-30528).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR18 Antibody (NBP2-30528) (0)

There are no reviews for WDR18 Antibody (NBP2-30528). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR18 Antibody (NBP2-30528) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional WDR18 Products

Bioinformatics Tool for WDR18 Antibody (NBP2-30528)

Discover related pathways, diseases and genes to WDR18 Antibody (NBP2-30528). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for WDR18 Antibody (NBP2-30528)

View related products by pathway.

PTMs for WDR18 Antibody (NBP2-30528)

Learn more about PTMs related to WDR18 Antibody (NBP2-30528).

Blogs on WDR18

There are no specific blogs for WDR18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our WDR18 Antibody and receive a gift card or discount.


Gene Symbol WDR18