CHTOP Antibody

Western Blot: CHTOP Antibody [NBP1-88085] - Analysis in control (vector only transfected HEK293T lysate) and CHTOP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: CHTOP Antibody [NBP1-88085] - Staining of human cell line A-431 shows localization to nuclear speckles & cytoplasmic bodies. Antibody staining is shown in green.

Immunohistochemistry-Frozen: CHTOP Antibody [NBP1-88085] - The staining was done on an E11.5 mouse transverse section (fixed on 4% PFA overnight) and done using standard IF techniques. Antibody at 1:50. Blocking: 1 hour with 1% BSA before addition of the primary antibody. Secondary antibody: Alexa Fluor Donkey Anti Rabbit 488. HC-Fr image submitted by a verified customer review.

Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human cerrebellum shows strong nuclear positivity in cells in granular layer.

Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.

Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CHTOP Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
• Predicted Species: Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHTOP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/mL
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. This CHTOP Antibody is validated for IHC-Fr from a verified customer review.
• Control Peptide:

  CHTOP Protein (NBP1-88085PEP)

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2), 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CHTOP Antibody

• C1orf77
• chromatin target of PRMT1
• DKFZP547E1010
• FOPMGC86949
• Friend of PRMT1 protein
• MGC131924
• pp7704
• RP1-178F15.2
• Small arginine- and glycine-rich protein
• small protein rich in arginine and glycine
• SRAGchromosome 1 open reading frame 77

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for CHTOP Antibody (NBP1-88085) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Prashan De Zoysa IHC-Fr Mouse 02/12/2021

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: E11.5 mouse embryo fixed in 4% PFA
• Species: Mouse
• Lot: R28090

Comments

• Comments: Dilution used - 1:50. The staining was done on an E11.5 mouse transverse section (fixed on 4% PFA overnight) and done using standard IF techniques.
  Blocking - 1 hour with 1% BSA before addition of the primary antibody
  Secondary antibody - Alexa Fluor Donkey Anti Rabbit 488
  ***Novus Innovators Program - new species or application used on a primary antibody.

Bioinformatics

• Gene Symbol: CHTOP