CHTOP Antibody

Images

 
Western Blot: CHTOP Antibody [NBP1-88085] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: CHTOP Antibody [NBP1-88085] - Staining of human cell line A-431 shows localization to nuclear speckles & cytoplasmic bodies.
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHTOP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHTOP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CHTOP Protein (NBP1-88085PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHTOP Antibody

  • C1orf77
  • chromatin target of PRMT1
  • DKFZP547E1010
  • FOPMGC86949
  • Friend of PRMT1 protein
  • MGC131924
  • pp7704
  • RP1-178F15.2
  • Small arginine- and glycine-rich protein
  • small protein rich in arginine and glycine
  • SRAGchromosome 1 open reading frame 77

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33500
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NB400-146
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P
H00011116-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-48546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NB100-59811
Species: Hu, Ca
Applications: WB, ICC/IF, IP
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
MAB3777
Species: Hu, Mu, Rt
Applications: WB
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88085
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CHTOP Antibody (NBP1-88085) (0)

There are no publications for CHTOP Antibody (NBP1-88085).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHTOP Antibody (NBP1-88085) (0)

There are no reviews for CHTOP Antibody (NBP1-88085). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHTOP Antibody (NBP1-88085) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHTOP Products

Bioinformatics Tool for CHTOP Antibody (NBP1-88085)

Discover related pathways, diseases and genes to CHTOP Antibody (NBP1-88085). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHTOP Antibody (NBP1-88085)

Discover more about diseases related to CHTOP Antibody (NBP1-88085).
 

Pathways for CHTOP Antibody (NBP1-88085)

View related products by pathway.

PTMs for CHTOP Antibody (NBP1-88085)

Learn more about PTMs related to CHTOP Antibody (NBP1-88085).

Blogs on CHTOP

There are no specific blogs for CHTOP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHTOP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHTOP