CHTOP Antibody

Images

 
Western Blot: CHTOP Antibody [NBP1-88085] - Analysis in control (vector only transfected HEK293T lysate) and CHTOP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: CHTOP Antibody [NBP1-88085] - Staining of human cell line A-431 shows localization to nuclear speckles & cytoplasmic bodies. Antibody staining is shown in green.
Immunohistochemistry-Frozen: CHTOP Antibody [NBP1-88085] - The staining was done on an E11.5 mouse transverse section (fixed on 4% PFA overnight) and done using standard IF techniques. Antibody at 1:50. Blocking: 1 hour ...read more
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human cerrebellum shows strong nuclear positivity in cells in granular layer.
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human skeleteal muscle shows strong nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHTOP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
Predicted Species
Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHTOP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. This CHTOP Antibody is validated for IHC-Fr from a verified customer review.
Control Peptide
CHTOP Protein (NBP1-88085PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-88085 in the following applications:

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHTOP Antibody

  • C1orf77
  • chromatin target of PRMT1
  • DKFZP547E1010
  • FOPMGC86949
  • Friend of PRMT1 protein
  • MGC131924
  • pp7704
  • RP1-178F15.2
  • Small arginine- and glycine-rich protein
  • small protein rich in arginine and glycine
  • SRAGchromosome 1 open reading frame 77

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF637
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
314-BP/CF
Species: Hu
Applications: BA, BA
NBP1-84685
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-146
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
6057-NG/CF
Species: Hu
Applications: BA
H00011116-M01
Species: Hu, Mu, Rb
Applications: ELISA, ICC/IF, IHC, IHC-Fr, WB
NBP2-48546
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF6989
Species: Mu
Applications: IHC
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NB100-59811
Species: Ca, Hu, Mu
Applications: ICC/IF, IP, KD, WB
NBP1-90813
Species: Hu
Applications: IHC, IHC-P, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-57508
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67074
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
AF5129
Species: Hu
Applications: WB
MAB3777
Species: Hu, Mu, Rt
Applications: WB
NBP1-88795
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-88085
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for CHTOP Antibody (NBP1-88085) (0)

There are no publications for CHTOP Antibody (NBP1-88085).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for CHTOP Antibody (NBP1-88085) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-88085:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen CHTOP NBP1-88085
Enlarge
5
reviewed by:
Verified Customer
IHC-Fr Mouse 02/12/2021
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedE11.5 mouse embryo fixed in 4% PFA
SpeciesMouse
LotR28090

Comments

CommentsDilution used - 1:50. The staining was done on an E11.5 mouse transverse section (fixed on 4% PFA overnight) and done using standard IF techniques.
Blocking - 1 hour with 1% BSA before addition of the primary antibody
Secondary antibody - Alexa Fluor Donkey Anti Rabbit 488
***Novus Innovators Program - new species or application used on a primary antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHTOP Antibody (NBP1-88085) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHTOP Products

Bioinformatics Tool for CHTOP Antibody (NBP1-88085)

Discover related pathways, diseases and genes to CHTOP Antibody (NBP1-88085). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHTOP Antibody (NBP1-88085)

Discover more about diseases related to CHTOP Antibody (NBP1-88085).
 

Pathways for CHTOP Antibody (NBP1-88085)

View related products by pathway.

PTMs for CHTOP Antibody (NBP1-88085)

Learn more about PTMs related to CHTOP Antibody (NBP1-88085).

Blogs on CHTOP

There are no specific blogs for CHTOP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
02/12/2021
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol CHTOP