MDN1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MDN1 Antibody [NBP1-81521] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
Immunohistochemistry: MDN1 Antibody [NBP1-81521] - Staining of human urinary bladder shows cytoplasmic and membranous positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MDN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QINEEISHLISFCLYHTPVTPQELRDLWSLLHHQKVSPEEITSLWSELFNSMFMSFWSSTVTTNPEYWLMWNPLPGMQQREAPKSVLDSTLKG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MDN1 Protein (NBP1-81521PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MDN1 Antibody

  • DKFZp686H16106
  • FLJ25587
  • FLJ43191
  • KIAA0301
  • MDN1, midasin homolog (yeast)
  • MIDAS-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30928
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-75515
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF7385
Species: Hu
Applications: WB, ICC
NBP3-09260
Species: Hu
Applications: WB
NBP1-88573
Species: Hu
Applications: WB, IHC, IHC-P
H00030008-B01P
Species: Hu
Applications: WB, Flow
NBP1-56590
Species: Hu, Rt
Applications: WB, IHC, IF
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
AF2307
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB200-331
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-20888
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP1-77374
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-81521
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MDN1 Antibody (NBP1-81521) (0)

There are no publications for MDN1 Antibody (NBP1-81521).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDN1 Antibody (NBP1-81521) (0)

There are no reviews for MDN1 Antibody (NBP1-81521). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MDN1 Antibody (NBP1-81521) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MDN1 Products

Array NBP1-81521

Bioinformatics Tool for MDN1 Antibody (NBP1-81521)

Discover related pathways, diseases and genes to MDN1 Antibody (NBP1-81521). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDN1 Antibody (NBP1-81521)

Discover more about diseases related to MDN1 Antibody (NBP1-81521).
 

Pathways for MDN1 Antibody (NBP1-81521)

View related products by pathway.

PTMs for MDN1 Antibody (NBP1-81521)

Learn more about PTMs related to MDN1 Antibody (NBP1-81521).
 

Research Areas for MDN1 Antibody (NBP1-81521)

Find related products by research area.

Blogs on MDN1

There are no specific blogs for MDN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MDN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MDN1