WDR12 Antibody

Images

 
Western Blot: WDR12 Antibody [NBP1-53111] - Jurkat cell lysate, concentration 5.0ug/ml.
Immunohistochemistry: WDR12 Antibody [NBP1-53111] - Human Lung cell Cellular data: alveolar cell Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR12 Antibody Summary

Immunogen
Synthetic peptides corresponding to WDR12 (WD repeat domain 12) The peptide sequence was selected from the C terminal of WDR12. Peptide sequence DTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSH.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR12
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against WDR12 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for WDR12 Antibody

  • FLJ10881
  • FLJ12719
  • FLJ12720
  • ribosome biogenesis protein WDR12
  • WD repeat domain 12
  • WD repeat-containing protein 12
  • YTM1

Background

WDR12 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. The function of this protein is not known.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein is highly similar to the mouse WD repeat domain 12 protein at the amino acid level. The function of this protein is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1258
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-21389
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-31364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-81521
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1318
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-89283
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-84232
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00641
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for WDR12 Antibody (NBP1-53111) (0)

There are no publications for WDR12 Antibody (NBP1-53111).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR12 Antibody (NBP1-53111) (0)

There are no reviews for WDR12 Antibody (NBP1-53111). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR12 Antibody (NBP1-53111) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDR12 Products

WDR12 NBP1-53111

Bioinformatics Tool for WDR12 Antibody (NBP1-53111)

Discover related pathways, diseases and genes to WDR12 Antibody (NBP1-53111). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR12 Antibody (NBP1-53111)

Discover more about diseases related to WDR12 Antibody (NBP1-53111).
 

Pathways for WDR12 Antibody (NBP1-53111)

View related products by pathway.

Blogs on WDR12

There are no specific blogs for WDR12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR12
Uniprot