WBSCR22 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: WBSCR22 Antibody [NBP2-13520] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Immunohistochemistry-Paraffin: WBSCR22 Antibody [NBP2-13520] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WBSCR22 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: ELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WBSCR22
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  WBSCR22 Protein (NBP2-13520PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%). Human reactivity reported in scientific literature (PMID: 25851604).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WBSCR22 Antibody - BSA Free

• EC 2.1.1.-
• FLJ44236
• HASJ4442
• HUSSY-3
• MGC19709
• MGC2022
• MGC5140
• PP3381
• WBMT
• Williams Beuren syndrome chromosome region 22 protein
• Williams Beuren syndrome chromosome region 22
• Williams-Beuren candidate region putative methyltransferase
• Williams-Beuren syndrome chromosomal region 22 protein

Background

WBSCR22 encodes a protein containing a nuclear localization signal and an S-adenosyl-L-methionine binding motif typical of methyltransferases, suggesting that the encoded protein may act on DNA methylation. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WBSCR22 Antibody (NBP2-13520)(1)

Publication using NBP2-13520

• Zorbas C, Nicolas E, Wacheul L et al. The human 18S rRNA base methyltransferases DIMT1L and WBSCR22-TRMT112 but not rRNA modification are required for ribosome biogenesis. Mol Biol Cell 2015-06-01 [PMID: 25851604] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: WBSCR22