WBSCR22 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: WBSCR22 Antibody [NBP2-13520] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: WBSCR22 Antibody [NBP2-13520] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WBSCR22 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGT GLSGSYLSDEGHYWVGLDISPAMLDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WBSCR22
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WBSCR22 Protein (NBP2-13520PEP)
Publications
Read Publication using
NBP2-13520 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%). Human reactivity reported in scientific literature (PMID: 25851604).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WBSCR22 Antibody

  • EC 2.1.1.-
  • FLJ44236
  • HASJ4442
  • HUSSY-3
  • MGC19709
  • MGC2022
  • MGC5140
  • PP3381
  • WBMT
  • Williams Beuren syndrome chromosome region 22 protein
  • Williams Beuren syndrome chromosome region 22
  • Williams-Beuren candidate region putative methyltransferase
  • Williams-Beuren syndrome chromosomal region 22 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37343
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-31833
Species: Hu
Applications: IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
H00011321-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-496
Species: Hu
Applications: WB, IHC-P, IP
H00084277-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90034
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-46161
Species: Hu
Applications: WB, IHC
NBP1-90010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33574
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for WBSCR22 Antibody (NBP2-13520)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for WBSCR22 Antibody (NBP2-13520) (0)

There are no reviews for WBSCR22 Antibody (NBP2-13520). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WBSCR22 Antibody (NBP2-13520) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WBSCR22 Products

Bioinformatics Tool for WBSCR22 Antibody (NBP2-13520)

Discover related pathways, diseases and genes to WBSCR22 Antibody (NBP2-13520). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WBSCR22 Antibody (NBP2-13520)

Discover more about diseases related to WBSCR22 Antibody (NBP2-13520).
 

Pathways for WBSCR22 Antibody (NBP2-13520)

View related products by pathway.

PTMs for WBSCR22 Antibody (NBP2-13520)

Learn more about PTMs related to WBSCR22 Antibody (NBP2-13520).

Blogs on WBSCR22

There are no specific blogs for WBSCR22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WBSCR22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WBSCR22