WBSCR22 Antibody


Immunocytochemistry/ Immunofluorescence: WBSCR22 Antibody [NBP2-13520] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: WBSCR22 Antibody [NBP2-13520] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

WBSCR22 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGT GLSGSYLSDEGHYWVGLDISPAMLDE
Specificity of human WBSCR22 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WBSCR22 Protein (NBP2-13520PEP)
Read Publication using
NBP2-13520 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%). Human reactivity reported in scientific literature (PMID: 25851604).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for WBSCR22 Antibody

  • EC 2.1.1.-
  • FLJ44236
  • HASJ4442
  • HUSSY-3
  • MGC19709
  • MGC2022
  • MGC5140
  • PP3381
  • WBMT
  • Williams Beuren syndrome chromosome region 22 protein
  • Williams Beuren syndrome chromosome region 22
  • Williams-Beuren candidate region putative methyltransferase
  • Williams-Beuren syndrome chromosomal region 22 protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for WBSCR22 Antibody (NBP2-13520)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for WBSCR22 Antibody (NBP2-13520) (0)

There are no reviews for WBSCR22 Antibody (NBP2-13520). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WBSCR22 Antibody (NBP2-13520) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional WBSCR22 Products

Bioinformatics Tool for WBSCR22 Antibody (NBP2-13520)

Discover related pathways, diseases and genes to WBSCR22 Antibody (NBP2-13520). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WBSCR22 Antibody (NBP2-13520)

Discover more about diseases related to WBSCR22 Antibody (NBP2-13520).

Pathways for WBSCR22 Antibody (NBP2-13520)

View related products by pathway.

PTMs for WBSCR22 Antibody (NBP2-13520)

Learn more about PTMs related to WBSCR22 Antibody (NBP2-13520).

Blogs on WBSCR22

There are no specific blogs for WBSCR22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our WBSCR22 Antibody and receive a gift card or discount.


Gene Symbol WBSCR22