Home » ZACN » ZACN Antibodies » ZACN Antibody

ZACN Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ZACN Antibody [NBP1-80104] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: ZACN Antibody [NBP1-80104] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Po, Ca, EqSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ZACN Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human LGICZ1. Peptide sequence PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Porcine (100%), Canine (100%), Equine (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZACN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against LGICZ1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZACN Antibody

  • L2
  • LGICZ1
  • ligand-gated ion channel subunit
  • ligand-gated ion channel, zinc activated 1
  • ligand-gated ion-channel receptor L2
  • MGC129841
  • ZAC
  • ZAC1
  • zinc activated ligand-gated ion channel 1
  • zinc activated ligand-gated ion channel
  • zinc-activated ligand-gated ion channel

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

FAM49B Antibody
NBP1-88582
Western Blot: FAM49B Antibody [NBP1-88582] - Analysis in human cell line A-431.
Immunocytochemistry/Immunofluorescence: FAM49B Antibody [NBP1-88582] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: FAM49B Antibody [NBP1-88582] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RPL3 Antibody
NBP2-20214
Western Blot: RPL3 Antibody [NBP2-20214] - Sample (30 ug of whole cell lysate) A: JurKat B: Raji 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: RPL3 Antibody [NBP2-20214] - Analysis of methanol-fixed A431, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: RPL3 Antibody [NBP2-20214] - Paraffin-embedded mouse intestine diluted at 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
LASS2 Antibody
(1A6)
H00029956-M01A
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - Human neuroblastoma cells untreated or treated with various drugs. Image from verified customer review.
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - S2 monoclonal antibody (M01), clone 1A6 Western Blot analysis of LASS2 expression in HepG2.
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - S2 monoclonal antibody (M01), clone 1A6. Western Blot analysis of LASS2 expression in NIH/3T3.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC
RPL4 Antibody (4A3)
H00006124-M01
Western Blot: RPL4 Antibody (4A3) [H00006124-M01] - RPL4 monoclonal antibody (M01), clone 4A3 Analysis of RPL4 expression in K-562.
Immunocytochemistry/Immunofluorescence: RPL4 Antibody (4A3) [H00006124-M01] - Analysis of monoclonal antibody to RPL4 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: RPL4 Antibody (4A3) [H00006124-M01] - RPL4 monoclonal antibody (M01), clone 4A3. Analysis of RPL4 expression in PC-12.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
FAM60A Antibody
H00058516-B02P
Western Blot: FAM60A Antibody [H00058516-B02P] - Analysis of FAM60A expression in transfected 293T cell line by FAM60A polyclonal antibody. Lane 1: FAM60A transfected lysate(24.31 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: FAM60A Antibody [H00058516-B02P] - Analysis of purified antibody to FAM60A on HeLa cell. (antibody concentration 30 ug/ml)
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
RPL5 Antibody
NBP1-31413
Western Blot: RPL5 Antibody [NBP1-31413] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RPL5 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: RPL5 Antibody [NBP1-31413] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RPL5 protein stained by RPL5 antibody diluted at 1:500. Blue: Hoechst 33342 staining.Scale bar = 10 um.
Immunohistochemistry-Paraffin: RPL5 Antibody [NBP1-31413] - Paraffin-embedded mouse hind brain. RPL5 antibody diluted at 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
TM4SF1/L6 Antibody
NBP1-76549
Western Blot: TM4SF1/L6 Antibody [NBP1-76549] - Human lung tissue lysate with TM4SF1 antibody at (A) 0.5 and (B) 1 ug/mL.
Immunohistochemistry-Paraffin: TM4SF1/L6 Antibody [NBP1-76549] - Staining of TM4SF1 in mouse lung tissue with TM4SF1 antibody at 5 ug/mL.
Immunohistochemistry-Paraffin: TM4SF1/L6 Antibody [NBP1-76549] - Mouse lung tissue with TM4SF1 antibody at 2 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
RPL6 Antibody
NBP2-20216
Western Blot: RPL6 Antibody [NBP2-20216] - Sample (30 ug of whole cell lysate) A: A549 B: H1299 C: HCT116 D: MCF-7 12% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: RPL6 Antibody [NBP2-20216] - Immunofluorescence analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: RPL6 Antibody [NBP2-20216] - Paraffin-embedded rat fore brain. RPL6 antibody dilution: 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MED10 Antibody
NBP1-81328
Western Blot: MED10 Antibody [NBP1-81328] - Analysis in control (vector only transfected HEK293T lysate) and MED10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: MED10 Antibody [NBP1-81328] - Staining of human cell line PC-3 shows localization to nucleoplasm. Antibody staining is shown in green.
Species: Hu
Applications: WB, ICC/IF
Rpn2 Antibody
NBP2-38323
Western Blot: Rpn2 Antibody [NBP2-38323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: Rpn2 Antibody [NBP2-38323] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & actin filaments.
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human liver.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CD6 [Unconjugated]
627-CD
CD6 [Unconjugated]
(7 Publications)
Species: Hu
CD2 Antibody
(3D1E3)
NBP2-61727
Western Blot: CD2 Antibody (3D1E3) [NBP2-61727] - Analysis using CD2 mAb against HEK293 (1) and CD2 (AA: 25-140)-hIgGFc transfected HEK293 (2) cell lysate.
Immunohistochemistry-Paraffin: CD2 Antibody (3D1E3) [NBP2-61727] - Analysis of endometrial cancer tissues using CD2 mouse mAb with DAB staining.
Flow Cytometry: CD2 Antibody (3D1E3) [NBP2-61727] - Analysis of HepG2 cells using CD2 mouse mAb (green) and negative control (red).
(1 Review)
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, MiAr
DBT Antibody
(OTI1G2)
NBP2-02042
Western Blot: DBT Antibody (OTI1G2) [NBP2-02042] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DBT (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DBT.
Immunocytochemistry/Immunofluorescence: DBT Antibody (OTI1G2) [NBP2-02042] - Anti-DBT mouse monoclonal antibody (NBP2-02042) immunofluorescent staining of COS7 cells transiently transfected by pCMV6-ENTRY DBT.
Flow Cytometry: DBT Antibody (OTI1G2) [NBP2-02042] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DBT antibody, and then analyzed by flow cytometry.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
PLAGL1 Antibody
(8D8C5)
NBP2-37343
Western Blot: PLAGL1 Antibody (8D8C5) [NBP2-37343] - Western blot analysis using PLAGL1 mAb against HEK293 (1) and PLAGL1 (AA: 118-222)-hIgGFc transfected HEK293 (2) cell lysate.
Immunohistochemistry-Paraffin: PLAGL1 Antibody (8D8C5) [NBP2-37343] - Analysis of ovarian cancer tissues using PLAGL1 mouse mAb with DAB staining.
Western Blot: PLAGL1 Antibody (8D8C5) [NBP2-37343] - Western blot analysis using PLAGL1 mAb against human PLAGL1 recombinant protein. (Expected MW is 37.5 kDa)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
hnRNP C1 + C2
Antibody (SN0652)
NBP2-67656
Western Blot: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of hnRNP C1+C2 on different lysates using anti-hnRNP C1+C2 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: MCF-7 Lane 3: HepG2
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in B16-F1 (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of paraffin-embedded mouse skin tissue using anti-hnRNP C1+C2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
FANCB Antibody
(M38P3E10)
NBP2-52406
Immunohistochemistry-Paraffin: FANCB Antibody (M38P3E10) [NBP2-52406] - Staining was performed on formalin-fixed, paraffin-embedded human breast cancer tissue sections using anti-FANCB [M38P3E10]. The antibody shows both nuclear and cytoplasmic staining but it is predominately cytoplasmic.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Butyrylcholinesterase/
NBP2-89134
Western Blot: Butyrylcholinesterase/BCHE Antibody [NBP2-89134] - Analysis of BCHE on human blood plasma using anti-BCHE antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Butyrylcholinesterase/BCHE Antibody [NBP2-89134] - Staining BCHE in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Butyrylcholinesterase/BCHE Antibody [NBP2-89134] - Immunohistochemical analysis of paraffin-embedded human prostate tissue using anti-Butyrylcholinesterase/BCHE antibody. Counter stained with hematoxylin.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZACN Antibody (NBP1-80104) (0)

There are no publications for ZACN Antibody (NBP1-80104).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZACN Antibody (NBP1-80104) (0)

There are no reviews for ZACN Antibody (NBP1-80104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZACN Antibody (NBP1-80104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ZACN Products

Array NBP1-80104

Bioinformatics Tool for ZACN Antibody (NBP1-80104)

Discover related pathways, diseases and genes to ZACN Antibody (NBP1-80104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZACN Antibody (NBP1-80104)

Discover more about diseases related to ZACN Antibody (NBP1-80104).

Blogs on ZACN

There are no specific blogs for ZACN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZACN Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ZACN
Uniprot