ZACN Antibody

Images

 
Western Blot: ZACN Antibody [NBP1-80104] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Po, Ca, EqSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZACN Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human LGICZ1. Peptide sequence PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Porcine (100%), Canine (100%), Equine (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZACN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against LGICZ1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZACN Antibody

  • L2
  • LGICZ1
  • ligand-gated ion channel subunit
  • ligand-gated ion channel, zinc activated 1
  • ligand-gated ion-channel receptor L2
  • MGC129841
  • ZAC
  • ZAC1
  • zinc activated ligand-gated ion channel 1
  • zinc activated ligand-gated ion channel
  • zinc-activated ligand-gated ion channel

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
H00058516-B02P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61727
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, MiAr
NBP2-02042
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
NBP2-37343
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-89134
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZACN Antibody (NBP1-80104) (0)

There are no publications for ZACN Antibody (NBP1-80104).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZACN Antibody (NBP1-80104) (0)

There are no reviews for ZACN Antibody (NBP1-80104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZACN Antibody (NBP1-80104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZACN Products

Array NBP1-80104

Bioinformatics Tool for ZACN Antibody (NBP1-80104)

Discover related pathways, diseases and genes to ZACN Antibody (NBP1-80104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZACN Antibody (NBP1-80104)

Discover more about diseases related to ZACN Antibody (NBP1-80104).

Blogs on ZACN

There are no specific blogs for ZACN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZACN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZACN
Uniprot