ZACN Antibody

Western Blot: ZACN Antibody [NBP1-80104] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ZACN Antibody Summary

• Immunogen: Synthetic peptide directed towards the N terminal of human LGICZ1. Peptide sequence PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZACN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against LGICZ1 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZACN Antibody

• L2
• LGICZ1
• ligand-gated ion channel subunit
• ligand-gated ion channel, zinc activated 1
• ligand-gated ion-channel receptor L2
• MGC129841
• ZAC
• ZAC1
• zinc activated ligand-gated ion channel 1
• zinc activated ligand-gated ion channel
• zinc-activated ligand-gated ion channel

Background

LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily ofligand-gated ion channels (Davies et al., 2003 (PubMed 12381728)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZACN
• Uniprot:
  • NP_851321(Human)