ZACN Antibody

Images

 
Western Blot: ZACN Antibody [NBP1-80104] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZACN Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human LGICZ1. Peptide sequence PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZACN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against LGICZ1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZACN Antibody

  • L2
  • LGICZ1
  • ligand-gated ion channel subunit
  • ligand-gated ion channel, zinc activated 1
  • ligand-gated ion-channel receptor L2
  • MGC129841
  • ZAC
  • ZAC1
  • zinc activated ligand-gated ion channel 1
  • zinc activated ligand-gated ion channel
  • zinc-activated ligand-gated ion channel

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00058516-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
CD6
627-CD
Species: Hu
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37343
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP1-80104
Species: Hu
Applications: WB

Publications for ZACN Antibody (NBP1-80104) (0)

There are no publications for ZACN Antibody (NBP1-80104).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZACN Antibody (NBP1-80104) (0)

There are no reviews for ZACN Antibody (NBP1-80104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZACN Antibody (NBP1-80104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZACN Products

Bioinformatics Tool for ZACN Antibody (NBP1-80104)

Discover related pathways, diseases and genes to ZACN Antibody (NBP1-80104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZACN Antibody (NBP1-80104)

Discover more about diseases related to ZACN Antibody (NBP1-80104).

Blogs on ZACN

There are no specific blogs for ZACN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZACN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZACN
Uniprot