Home » ZACN » ZACN Antibodies » ZACN Antibody

ZACN Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ZACN Antibody [NBP1-80104] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: ZACN Antibody [NBP1-80104] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ZACN Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human LGICZ1. Peptide sequence PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZACN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against LGICZ1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZACN Antibody

  • L2
  • LGICZ1
  • ligand-gated ion channel subunit
  • ligand-gated ion channel, zinc activated 1
  • ligand-gated ion-channel receptor L2
  • MGC129841
  • ZAC
  • ZAC1
  • zinc activated ligand-gated ion channel 1
  • zinc activated ligand-gated ion channel
  • zinc-activated ligand-gated ion channel

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

FAM49B Antibody
NBP1-88582
Western Blot: FAM49B Antibody [NBP1-88582] - Analysis in human cell line A-431.
Immunocytochemistry/Immunofluorescence: FAM49B Antibody [NBP1-88582] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: FAM49B Antibody [NBP1-88582] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RPL3 Antibody
NBP1-81332
Western Blot: RPL3 Antibody [NBP1-81332] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: RPL3 Antibody [NBP1-81332] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RPL3 Antibody [NBP1-81332] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear(nucleolar) positivity in neuronal cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
LASS2 Antibody
NBP1-84537
Western Blot: LASS2 Antibody [NBP1-84537] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: LASS2 Antibody [NBP1-84537] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear membrane & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LASS2 Antibody [NBP1-84537] - Staining of human skeletal muscle shows only weak cytoplasmic positivity in striated muscle fibers as expected.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
RPL4 Antibody (4A3)
H00006124-M01
Western Blot: RPL4 Antibody (4A3) [H00006124-M01] - RPL4 monoclonal antibody (M01), clone 4A3. Analysis of RPL4 expression in Raw 264.7.
Immunocytochemistry/Immunofluorescence: RPL4 Antibody (4A3) [H00006124-M01] - Analysis of monoclonal antibody to RPL4 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: RPL4 Antibody (4A3) [H00006124-M01] - RPL4 monoclonal antibody (M01), clone 4A3. Analysis of RPL4 expression in PC-12.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
FAM60A Antibody
H00058516-B02P
Western Blot: FAM60A Antibody [H00058516-B02P] - Analysis of FAM60A expression in transfected 293T cell line by FAM60A polyclonal antibody. Lane 1: FAM60A transfected lysate(24.31 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: FAM60A Antibody [H00058516-B02P] - Analysis of purified antibody to FAM60A on HeLa cell. (antibody concentration 30 ug/ml)
Species: Hu
Applications: WB, ELISA, ICC/IF
PCNA associated
factor Antibody (3C11 ...
H00009768-M01
Western Blot: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Western Blot analysis of KIAA0101 expression in JAR ( Cat # L003V1 ).
Immunocytochemistry/Immunofluorescence: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Analysis of monoclonal antibody to KIAA0101 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Analysis of monoclonal antibody to KIAA0101 on formalin-fixed paraffin-embedded human lymph node tissue. Antibody concentration 3 ug/ml.
(6 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
RPL5 Antibody
NBP1-31413
Western Blot: RPL5 Antibody [NBP1-31413] - Sample(30 ug whole cell lysate)A: A431 B: H1299 C: HeLaS3 D: MOLT4 12% SDS PAGE 1 diluted at 1:1000
Immunocytochemistry/Immunofluorescence: RPL5 Antibody [NBP1-31413] - Sample: HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RPL5 protein stained by RPL5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: RPL5 Antibody [NBP1-31413] - Paraffin-embedded mouse hind brain. RPL5 antibody diluted at 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
TM4SF1/L6 Antibody
(877621) [Unconjugate ...
MAB8164
TM4SF1/L6 was detected in immersion fixed A549 human lung carcinoma cell line using Mouse Anti-Human TM4SF1/L6 Monoclonal Antibody (Catalog # MAB8164) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell membranes. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
A549 human lung carcinoma cell line was stained with Mouse Anti-Human TM4SF1/L6 Monoclonal Antibody (Catalog # MAB8164, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). View our protocol for Staining Membrane-associated Proteins.
HEK293 human embryonic kidney cell line transfected with human TM4SF1/L6 and eGFP was stained with either (A) Mouse Anti-Human TM4SF1/L6 Monoclonal Antibody (Catalog # MAB8164) or (B) Mouse IgG1 Isotype Control (Catalog # MAB002) followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
(1 Publication)
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
RPL6 Antibody
NBP2-20216
Western Blot: RPL6 Antibody [NBP2-20216] - Sample (30 ug of whole cell lysate) A: A549 B: H1299 C: HCT116 D: MCF-7 12% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: RPL6 Antibody [NBP2-20216] - Immunofluorescence analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: RPL6 Antibody [NBP2-20216] - Paraffin-embedded rat fore brain. RPL6 antibody dilution: 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MED10 Antibody
NBP2-58707
Western Blot: MED10 Antibody [NBP2-58707] - Western blot analysis in control (vector only transfected HEK293T lysate) and MED10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: MED10 Antibody [NBP2-58707] - Staining of human cell line HeLa shows localization to nucleoplasm.
Species: Hu
Applications: WB, ICC/IF
Rpn2 Antibody
NB120-2941
Western Blot: Rpn2 Antibody [NB120-2941] - Analysis of proteasome 19S subunit S1 from HeLa cell extract.
(2 Publications)
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
CD6
627-CD
CD6
(7 Publications)
Species: Hu
CD2 Antibody
(RPA-2.10)
NBP2-25200
Flow Cytometry: CD2 Antibody (RPA-2.10) [NBP2-25200] - Analysis using the PE/Cy5 conjugate of NBP2-25200. Staining of normal human peripheral blood cells with Mouse IgG1 kappa Isotype Control PE-Cy5 (open histogram) or Anti-Human CD2 PE-Cy5 (filled histogram). Total cells were used for analysis.
Flow Cytometry: CD2 Antibody (RPA-2.10) [NBP2-25200] - Cell surface analysis of CD2 in 10^6 human lymphocytes using 0.25 ug of CD2 RPA-2.10 antibody; Shaded histogram represents cells without antibody; green represents isotype control ; red represents CD2 antibody. Goat anti-mouse IgG PE conjugated secondary was used in this test.
Flow Cytometry: CD2 Antibody (RPA-2.10) [NBP2-25200] - Analysis using the Alexa Fluor (R) 488 conjugate of NBP2-25200. Staining of CD2 in 10^6 human lymphocytes using 10 ul (0.25 ug) of this antibody. Shaded histogram represents cells without antibody; green represents isotype control ; red represents anti-CD2.
Species: Hu
Applications: WB, B/N, Flow, IHC, IHC-Fr
DBT Antibody
NBP1-89522
Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining in human kidney and pancreas tissues using anti-DBT antibody. Corresponding DBT RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PLAGL1 Antibody
(8D8C5)
NBP2-37343
Western Blot: PLAGL1 Antibody (8D8C5) [NBP2-37343] - Western blot analysis using PLAGL1 mAb against HEK293 (1) and PLAGL1 (AA: 118-222)-hIgGFc transfected HEK293 (2) cell lysate.
Immunohistochemistry: PLAGL1 Antibody (8D8C5) [NBP2-37343] - Immunohistochemical analysis of paraffin-embedded ovarian cancer tissues using PLAGL1 mouse mAb with DAB staining.
Western Blot: PLAGL1 Antibody (8D8C5) [NBP2-37343] - Western blot analysis using PLAGL1 mAb against human PLAGL1 recombinant protein. (Expected MW is 37.5 kDa)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
hnRNP C1 + C2
Antibody (CL2596)
NBP2-36777
Western Blot: hnRNP C1 + C2 Antibody (CL2596) [NBP2-36777] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-HNRNPC monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % inten
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (CL2596) [NBP2-36777] - Staining in U251 cell line showing distinct nuclear (without nucleoli)Staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.
Immunohistochemistry: hnRNP C1 + C2 Antibody (CL2596) [NBP2-36777] - Staining of human lymph node shows strong nuclear immunoreactivity in lymphocytes.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
FANCB Antibody
(M38P3E10)
NBP2-52406
Immunohistochemistry-Paraffin: FANCB Antibody (M38P3E10) [NBP2-52406] - Staining was performed on formalin-fixed, paraffin-embedded human breast cancer tissue sections using anti-FANCB [M38P3E10]. The antibody shows both nuclear and cytoplasmic staining but it is predominately cytoplasmic.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Butyrylcholinesterase/ ...
NBP2-03523
Western Blot: Butyrylcholinesterase Antibody (1E1) [NBP2-03523] Analysis of extracts (35ug) from 9 different cell lines by using anti-Butyrylcholinesterase monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Flow Cytometry: Butyrylcholinesterase Antibody (1E1) [NBP2-03523] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Butyrylcholinesterase antibody, and then analyzed by flow cytometry.
Western Blot: Butyrylcholinesterase Antibody (1E1) [NBP2-03523] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Butyrylcholinesterase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Butyrylcholinesterase.
Species: Hu, Ca
Applications: WB, Flow
ZACN Antibody
NBP1-80104
ZACN Antibody
Species: Hu
Applications: WB

Publications for ZACN Antibody (NBP1-80104) (0)

There are no publications for ZACN Antibody (NBP1-80104).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZACN Antibody (NBP1-80104) (0)

There are no reviews for ZACN Antibody (NBP1-80104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZACN Antibody (NBP1-80104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZACN Products

Bioinformatics Tool for ZACN Antibody (NBP1-80104)

Discover related pathways, diseases and genes to ZACN Antibody (NBP1-80104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZACN Antibody (NBP1-80104)

Discover more about diseases related to ZACN Antibody (NBP1-80104).

Blogs on ZACN

There are no specific blogs for ZACN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZACN Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ZACN
Uniprot