Home » ZACN » ZACN Antibodies » ZACN Antibody

ZACN Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ZACN Antibody [NBP1-80104] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: ZACN Antibody [NBP1-80104] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ZACN Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human LGICZ1. Peptide sequence PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZACN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against LGICZ1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZACN Antibody

  • L2
  • LGICZ1
  • ligand-gated ion channel subunit
  • ligand-gated ion channel, zinc activated 1
  • ligand-gated ion-channel receptor L2
  • MGC129841
  • ZAC
  • ZAC1
  • zinc activated ligand-gated ion channel 1
  • zinc activated ligand-gated ion channel
  • zinc-activated ligand-gated ion channel

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

FAM49B Antibody
NBP1-88582
Western Blot: FAM49B Antibody [NBP1-88582] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: FAM49B Antibody [NBP1-88582] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.
Immunocytochemistry/Immunofluorescence: FAM49B Antibody [NBP1-88582] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RPL3 Antibody
NBP2-20214
Western Blot: RPL3 Antibody [NBP2-20214] - Sample (30 ug of whole cell lysate) A: JurKat B: Raji 10% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: RPL3 Antibody [NBP2-20214] - 4T1 xenograft, using RPL3 antibody at 1:500 dilution. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunocytochemistry/Immunofluorescence: RPL3 Antibody [NBP2-20214] - Analysis of methanol-fixed A431, using antibody at 1:200 dilution.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
LASS2 Antibody
(1A6)
H00029956-M01A
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - S2 monoclonal antibody (M01), clone 1A6 Western Blot analysis of LASS2 expression in HepG2.
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - S2 monoclonal antibody (M01), clone 1A6. Western Blot analysis of LASS2 expression in NIH/3T3.
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - Human neuroblastoma cells untreated or treated with various drugs. Image from verified customer review.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, WB
RPL4 Antibody (4A3)
H00006124-M01
Western Blot: RPL4 Antibody (4A3) [H00006124-M01] - RPL4 monoclonal antibody (M01), clone 4A3 Analysis of RPL4 expression in K-562.
Immunocytochemistry/Immunofluorescence: RPL4 Antibody (4A3) [H00006124-M01] - Analysis of monoclonal antibody to RPL4 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: RPL4 Antibody (4A3) [H00006124-M01] - Detection limit for recombinant GST tagged RPL4 is approximately 0.3ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
FAM60A Antibody
H00058516-B02P
Western Blot: FAM60A Antibody [H00058516-B02P] - Analysis of FAM60A expression in transfected 293T cell line by FAM60A polyclonal antibody. Lane 1: FAM60A transfected lysate(24.31 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: FAM60A Antibody [H00058516-B02P] - Analysis of purified antibody to FAM60A on HeLa cell. (antibody concentration 30 ug/ml)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
RPL5 Antibody
NBP1-31413
Immunocytochemistry/Immunofluorescence: RPL5 Antibody [NBP1-31413] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RPL5 protein stained by RPL5 antibody diluted at 1:500. Blue: Hoechst 33342 staining.Scale bar = 10 um.
Western Blot: RPL5 Antibody [NBP1-31413] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RPL5 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Knockdown Validated: RPL5 Antibody [NBP1-31413] - Western Blot analysis of RPL5 protein expressions in CD71highTer119high cells. There was a significant decrease in the expression level of RPL5 in the treated shRNA Rpl5 compared to the control mice. Image collected and cropped by CiteAb from the following publication (www.discoveriesjournals.org/discoveries/D.2019.03.DI-Kazerounian-Beggs.DOI) licensed under a CC-BY licence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
TM4SF1/L6 Antibody
(877621) [Unconjugate ...
MAB8164
TM4SF1/L6 was detected in immersion fixed A549 human lung carcinoma cell line using Mouse Anti-Human TM4SF1/L6 Monoclonal Antibody (Catalog # MAB8164) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell membranes. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
A549 human lung carcinoma cell line was stained with Mouse Anti-Human TM4SF1/L6 Monoclonal Antibody (Catalog # MAB8164, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). View our protocol for Staining Membrane-associated Proteins.
HEK293 human embryonic kidney cell line transfected with human TM4SF1/L6 and eGFP was stained with either (A) Mouse Anti-Human TM4SF1/L6 Monoclonal Antibody (Catalog # MAB8164) or (B) Mouse IgG1 Isotype Control (Catalog # MAB002) followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
RPL6 Antibody
NBP2-20216
Immunohistochemistry-Paraffin: RPL6 Antibody [NBP2-20216] - Paraffin-embedded lung carcinoma. RPL6 antibody dilution: 1:500.
Immunohistochemistry-Paraffin: RPL6 Antibody [NBP2-20216] - Paraffin-embedded mouse stomach. RPL6 antibody dilution: 1:500.
Immunohistochemistry-Paraffin: RPL6 Antibody [NBP2-20216] - Paraffin-embedded rat fore brain. RPL6 antibody dilution: 1:500.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MED10 Antibody
NBP1-81328
Western Blot: MED10 Antibody [NBP1-81328] - Analysis in control (vector only transfected HEK293T lysate) and MED10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: MED10 Antibody [NBP1-81328] - Staining of human cell line PC-3 shows localization to nucleoplasm. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, WB
Rpn2 Antibody
NBP2-38323
Immunocytochemistry/Immunofluorescence: Rpn2 Antibody [NBP2-38323] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & actin filaments.
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human cerebral cortex, kidney, liver and testis using Anti-PSMD1 antibody NBP2-38323 (A) shows similar protein distribution across tissues to independent antibody NBP2-38324 (B).
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human testis.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CD6 [Unconjugated]
627-CD
CD6 [Unconjugated]
(7 Publications)
Species: Hu
Applications: BA
CD2 Antibody
(RPA-2.10)
NBP2-25200
Flow Cytometry: CD2 Antibody (RPA-2.10) [NBP2-25200] - Analysis using the PE/Cy5 conjugate of NBP2-25200. Staining of normal human peripheral blood cells with Mouse IgG1 kappa Isotype Control PE-Cy5 (open histogram) or Anti-Human CD2 PE-Cy5 (filled histogram). Total cells were used for analysis.
Flow Cytometry: CD2 Antibody (RPA-2.10) [NBP2-25200] - Analysis using the Alexa Fluor (R) 488 conjugate of NBP2-25200. Staining of CD2 in 10^6 human lymphocytes using 10 ul (0.25 ug) of this antibody. Shaded histogram represents cells without antibody; green represents isotype control ; red represents anti-CD2.
Flow Cytometry: CD2 Antibody (RPA-2.10) [NBP2-25200] - Analysis using the Allophycocyanin conjugate of NBP2-25200. Staining of normal human peripheral blood cells with Mouse IgG1 kappa Isotype Control APC (open histogram) or Anti-Human CD2 APC (filled histogram). Cells in the lymphocyte gate were used for analysis.
(1 Review)
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
DBT Antibody
NBP1-89522
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human pancreas shows weak to moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PLAGL1 Antibody
(8D8C5)
NBP2-37343
ELISA: PLAGL1 Antibody (8D8C5) [NBP2-37343] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: PLAGL1 Antibody (8D8C5) [NBP2-37343] - Western blot analysis using PLAGL1 mAb against human PLAGL1 recombinant protein. (Expected MW is 37.5 kDa)
Western Blot: PLAGL1 Antibody (8D8C5) [NBP2-37343] - Western blot analysis using PLAGL1 mAb against HEK293 (1) and PLAGL1 (AA: 118-222)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
hnRNP C1 + C2
Antibody (SN0652)
NBP2-67656
Flow Cytometry: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of Hela cells with hnRNP C1+C2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(9 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
FANCB Antibody
(M38P3E10)
NBP2-52406
Immunohistochemistry-Paraffin: FANCB Antibody (M38P3E10) [NBP2-52406] - Staining was performed on formalin-fixed, paraffin-embedded human breast cancer tissue sections using anti-FANCB [M38P3E10]. The antibody shows both nuclear and cytoplasmic staining but it is predominately cytoplasmic.
Species: Hu
Applications: ELISA, IHC, IHC-P, WB

Butyrylcholinesterase/
NBP2-89134
Western Blot: Butyrylcholinesterase/BCHE Antibody [NBP2-89134] - Analysis of BCHE on human blood plasma using anti-BCHE antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Butyrylcholinesterase/BCHE Antibody [NBP2-89134] - Staining BCHE in LOVO cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Butyrylcholinesterase/BCHE Antibody [NBP2-89134] - Staining BCHE in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ZACN Antibody (NBP1-80104) (0)

There are no publications for ZACN Antibody (NBP1-80104).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZACN Antibody (NBP1-80104) (0)

There are no reviews for ZACN Antibody (NBP1-80104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZACN Antibody (NBP1-80104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ZACN Products

Array NBP1-80104

Bioinformatics Tool for ZACN Antibody (NBP1-80104)

Discover related pathways, diseases and genes to ZACN Antibody (NBP1-80104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZACN Antibody (NBP1-80104)

Discover more about diseases related to ZACN Antibody (NBP1-80104).

Blogs on ZACN

There are no specific blogs for ZACN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZACN Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ZACN
Uniprot