ABHD11 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ABHD11 Antibody [NBP2-33574] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ABHD11 Antibody [NBP2-33574] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Western Blot: ABHD11 Antibody [NBP2-33574] - Analysis in human cell line MCF-7.

Immunohistochemistry-Paraffin: ABHD11 Antibody [NBP2-33574] -Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: ABHD11 Antibody [NBP2-33574] -Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: ABHD11 Antibody [NBP2-33574] -Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ABHD11 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIMRLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABHD11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ABHD11 Protein (NBP2-33574PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ABHD11 Antibody - BSA Free

• abhydrolase domain containing 11
• abhydrolase domain-containing protein 11
• EC 3.-
• PP1226
• WBSCR21
• Williams Beuren syndrome chromosome region 21
• Williams-Beuren syndrome chromosomal region 21 protein

Background

ABHD11 encodes a protein containing an alpha/beta hydrolase fold domain. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ABHD11 Antibody (NBP2-33574)(1)

Publication using NBP2-33574

• Muller AK, Foll M, Heckelmann B et al. Proteomic Characterization of Prostate Cancer to Distinguish Nonmetastasizing and Metastasizing Primary Tumors and Lymph Node Metastases. Neoplasia 2017-12-14 [PMID: 29248718] (IHC-P, Human)

Bioinformatics

• Gene Symbol: ABHD11
• Uniprot:
  • Q8NFV4(Human)