NFS1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NFS1 Antibody [NBP2-37933] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: NFS1 Antibody [NBP2-37933] - Staining of human kidney.
Immunohistochemistry: NFS1 Antibody [NBP2-37933] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Independent Antibodies: Immunohistochemistry-Paraffin: NFS1 Antibody [NBP2-37933] - Staining of human cerebral cortex, colon, kidney and testis using Anti-NFS1 antibody NBP2-37933 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: NFS1 Antibody [NBP2-37933] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: NFS1 Antibody [NBP2-37933] - Staining of human colon.
Immunohistochemistry-Paraffin: NFS1 Antibody [NBP2-37933] - Staining of human testis.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

NFS1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSF
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NFS1 Protein (NBP2-37933PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NFS1 Antibody

  • cysteine desulfurase, mitochondrial
  • EC 2.8.1.7
  • NFS1 nitrogen fixation 1 homolog (S. cerevisiae)
  • NifS
  • NIFShomolog)
  • nitrogen-fixing bacteria S-like protein

Background

Iron-sulfur clusters are required for the function of many cellular enzymes. The protein encoded by this gene supplies inorganic sulfur to these clusters by removing the sulfur from cysteine, creating alanine in the process. This gene uses alternate in-frame translation initiation sites to generate mitochondrial forms and cytoplasmic/nuclear forms. Selection of the alternative initiation sites is determined by the cytosolic pH. The encoded protein belongs to the class-V family of pyridoxal phosphate-dependent aminotransferases. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14998
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
AF3059
Species: Mu
Applications: ICC, Simple Western, WB
NBP1-79672
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-48693
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87677
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-46506
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-87781
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-93574
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB6734
Species: Hu
Applications: IHC
NBP2-97312
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88606
Species: Hu
Applications: IHC, IHC-P, Simple Western
NBP3-16735
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-16001
Species: V
Applications: WB

Publications for NFS1 Antibody (NBP2-37933) (0)

There are no publications for NFS1 Antibody (NBP2-37933).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFS1 Antibody (NBP2-37933) (0)

There are no reviews for NFS1 Antibody (NBP2-37933). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NFS1 Antibody (NBP2-37933) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NFS1 Products

Bioinformatics Tool for NFS1 Antibody (NBP2-37933)

Discover related pathways, diseases and genes to NFS1 Antibody (NBP2-37933). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFS1 Antibody (NBP2-37933)

Discover more about diseases related to NFS1 Antibody (NBP2-37933).
 

Pathways for NFS1 Antibody (NBP2-37933)

View related products by pathway.

PTMs for NFS1 Antibody (NBP2-37933)

Learn more about PTMs related to NFS1 Antibody (NBP2-37933).

Blogs on NFS1

There are no specific blogs for NFS1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFS1
Uniprot