WASP Antibody

Images

 
Immunohistochemistry-Paraffin: WASp Antibody [NBP1-87827] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp and cells in white pulp.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WASP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WAS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WASP Protein (NBP1-87827PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WASP Antibody

  • IMD2THC
  • Thrombocytopenia 1
  • WAS
  • WASP
  • WiskTHC1
  • wiskthrombocytopenia 1 (X-linked)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86859
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
AF5514
Species: Hu, Mu
Applications: WB
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP2-37912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2038
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NB300-606
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-38367
Species: Hu
Applications: IB, ICC/IF, IHC, IHC-P
NBP1-87827
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for WASP Antibody (NBP1-87827) (0)

There are no publications for WASP Antibody (NBP1-87827).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WASP Antibody (NBP1-87827) (0)

There are no reviews for WASP Antibody (NBP1-87827). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for WASP Antibody (NBP1-87827) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WASP Products

Bioinformatics Tool for WASP Antibody (NBP1-87827)

Discover related pathways, diseases and genes to WASP Antibody (NBP1-87827). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WASP Antibody (NBP1-87827)

Discover more about diseases related to WASP Antibody (NBP1-87827).
 

Pathways for WASP Antibody (NBP1-87827)

View related products by pathway.

PTMs for WASP Antibody (NBP1-87827)

Learn more about PTMs related to WASP Antibody (NBP1-87827).
 

Research Areas for WASP Antibody (NBP1-87827)

Find related products by research area.

Blogs on WASP.

"Actin the Fool" about Cytoskeleton Structure
Actins are highly conserved, commonly found and abundant proteins involved in several types of cell motility as well as cytoskeleton maintenance. In vertebrate species, three main groups of actin isoforms, the alpha, beta and gamma, have been identifi...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WASP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WAS
Entrez