WARS2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: WARS2 Antibody [NBP2-57679] - Staining of human cell line U-2 OS shows localization to mitochondria.
Orthogonal Strategies: Immunohistochemistry-Paraffin: WARS2 Antibody [NBP2-57679] - Staining in human fallopian tube and pancreas tissues using anti-WARS2 antibody. Corresponding WARS2 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: WARS2 Antibody [NBP2-57679] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: WARS2 Antibody [NBP2-57679] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

WARS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MELVQDLAQGFNKKYGEFFPVPESILTSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTDFTSEVTYDPA
Specificity
Specificity of human WARS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WARS2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for WARS2 Antibody

  • (Mt)TrpRS
  • EC 6.1.1
  • EC 6.1.1.2
  • TrpRStryptophan-tRNA ligase
  • tryptophan tRNA ligase 2, mitochondrial
  • Tryptophan--tRNA ligase
  • tryptophanyl tRNA synthetase 2, mitochondrial
  • tryptophanyl-tRNA synthetase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20744
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86890
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92106
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
AF3999
Species: Hu
Applications: WB, KO
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-1793
Species: Hu, Mu, Mk
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-57679
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for WARS2 Antibody (NBP2-57679) (0)

There are no publications for WARS2 Antibody (NBP2-57679).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WARS2 Antibody (NBP2-57679) (0)

There are no reviews for WARS2 Antibody (NBP2-57679). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WARS2 Antibody (NBP2-57679) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional WARS2 Products

Bioinformatics Tool for WARS2 Antibody (NBP2-57679)

Discover related pathways, diseases and genes to WARS2 Antibody (NBP2-57679). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on WARS2

There are no specific blogs for WARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WARS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WARS2