Methionyl tRNA synthetase 2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments & aggresome.
Immunohistochemistry-Paraffin: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Methionyl tRNA synthetase 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLGVSASERSLGELYFLPRFYGHPCPFEGRRLGPETGLLFPRLDQSRTWLVKAHRT
Specificity
Specificity of human Methionyl tRNA synthetase 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MARS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Methionyl tRNA synthetase 2 Protein (NBP1-92106PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Methionyl tRNA synthetase 2 Antibody

  • EC 6.1.1
  • EC 6.1.1.10
  • methionine tRNA ligase 2, mitochondrial
  • Methionine--tRNA ligase 2
  • methionine-tRNA ligase
  • methionine-tRNA synthetase 2 (mitochondrial)
  • methionine-tRNA synthetase 2, mitochondrial
  • methionyl-tRNA synthetase 2, mitochondrial
  • methionyl-tRNA synthetase, mitochondrial
  • MetRS
  • Mitochondrial methionine--tRNA ligase
  • mitochondrial methionyl-tRNA synthetase
  • MtMetRS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86890
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91857
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57679
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86624
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27206
Species: Hu, Mu, Rt, Po, Bv, Ca, ChHa, Eq, Fe, GP, Op, Pm
Applications: WB, IHC-P
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3254
Species: Hu, Mu, Rt
Applications: WB
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-56375
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20744
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20567
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-92106
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Methionyl tRNA synthetase 2 Antibody (NBP1-92106) (0)

There are no publications for Methionyl tRNA synthetase 2 Antibody (NBP1-92106).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Methionyl tRNA synthetase 2 Antibody (NBP1-92106) (0)

There are no reviews for Methionyl tRNA synthetase 2 Antibody (NBP1-92106). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Methionyl tRNA synthetase 2 Antibody (NBP1-92106) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Methionyl tRNA synthetase 2 Antibody (NBP1-92106)

Discover related pathways, diseases and genes to Methionyl tRNA synthetase 2 Antibody (NBP1-92106). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Methionyl tRNA synthetase 2 Antibody (NBP1-92106)

Discover more about diseases related to Methionyl tRNA synthetase 2 Antibody (NBP1-92106).
 

Pathways for Methionyl tRNA synthetase 2 Antibody (NBP1-92106)

View related products by pathway.

Blogs on Methionyl tRNA synthetase 2

There are no specific blogs for Methionyl tRNA synthetase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Methionyl tRNA synthetase 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MARS2