QARS Antibody

Images

 
Western Blot: QARS Antibody [NBP1-89487] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: QARS Antibody [NBP1-89487] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.
Western Blot: QARS Antibody [NBP1-89487] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

QARS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
QARS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
QARS Protein (NBP1-89487PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for QARS Antibody

  • EC 6.1.1
  • EC 6.1.1.18
  • GLNRS
  • glutamine tRNA ligase
  • Glutamine--tRNA ligase
  • glutamine-tRNA synthetase
  • glutaminyl-tRNA synthetase
  • PRO2195

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20744
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54653
Species: Hu
Applications: WB
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92106
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83854
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87706
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82077
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for QARS Antibody (NBP1-89487) (0)

There are no publications for QARS Antibody (NBP1-89487).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for QARS Antibody (NBP1-89487) (0)

There are no reviews for QARS Antibody (NBP1-89487). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for QARS Antibody (NBP1-89487) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional QARS Products

Bioinformatics Tool for QARS Antibody (NBP1-89487)

Discover related pathways, diseases and genes to QARS Antibody (NBP1-89487). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for QARS Antibody (NBP1-89487)

Discover more about diseases related to QARS Antibody (NBP1-89487).
 

Pathways for QARS Antibody (NBP1-89487)

View related products by pathway.

Blogs on QARS

There are no specific blogs for QARS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our QARS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol QARS