![Western Blot: QARS Antibody [NBP1-89487] - Analysis using Anti-QARS antibody NBP1-89487 (A) shows similar pattern to independent antibody NBP2-37883 (B).](http://images.novusbio.com/fullsize2/QARS-Antibody-Western-Blot-NBP1-89487-img0010.jpg "Western Blot: QARS Antibody [NBP1-89487] - Analysis using Anti-QARS antibody NBP1-89487 (A) shows similar pattern to independent antibody NBP2-37883 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDA |
| Specificity | Specificity of human, mouse, rat QARS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | QARS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89487 | Applications | Species |
|---|---|---|
| Kong J, Kim S Cell-based analysis of pairwise interactions between the components of the multi-tRNA synthetase complex FASEB J. Jun 15 2020 [PMID: 32539228] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for QARS Antibody (NBP1-89487)Discover more about diseases related to QARS Antibody (NBP1-89487).
| Pathways for QARS Antibody (NBP1-89487)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | QARS1 |
![Immunocytochemistry/Immunofluorescence: QARS Antibody [NBP1-89487] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/QARS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89487-img0007.jpg "Immunocytochemistry/Immunofluorescence: QARS Antibody [NBP1-89487] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize2/QARS-Antibody-Immunohistochemistry-Paraffin-NBP1-89487-img0013.jpg "Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human cerebral cortex.")
![Western Blot: QARS Antibody [NBP1-89487] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize2/QARS-Antibody-Western-Blot-NBP1-89487-img0006.jpg "Western Blot: QARS Antibody [NBP1-89487] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human cerebral cortex, colon, liver and testis using Anti-QARS antibody NBP1-89487 (A) shows similar protein distribution across tissues to independent antibody NBP2-37883 (B).](http://images.novusbio.com/fullsize2/QARS-Antibody-Immunohistochemistry-Paraffin-NBP1-89487-img0009.jpg "Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human cerebral cortex, colon, liver and testis using Anti-QARS antibody NBP1-89487 (A) shows similar protein distribution across tissues to independent antibody NBP2-37883 (B).")
![Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human liver.](http://images.novusbio.com/fullsize2/QARS-Antibody-Immunohistochemistry-Paraffin-NBP1-89487-img0011.jpg "Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human liver.")
![Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human colon.](http://images.novusbio.com/fullsize2/QARS-Antibody-Immunohistochemistry-Paraffin-NBP1-89487-img0012.jpg "Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human colon.")
![Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human testis.](http://images.novusbio.com/fullsize2/QARS Antibody-Immunohistochemistry-Paraffin-NBP1-89487-img0014.jpg "Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human testis.")
![Immunocytochemistry/Immunofluorescence: EARS2 Antibody [NBP1-91856] - Immunofluorescent staining of human cell line Hep G2 shows localization to mitochondria.](http://images.novusbio.com/images2/EARS2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91856-img0005.jpg)
![Immunohistochemistry-Paraffin: EARS2 Antibody [NBP1-91856] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules and cells in glomeruli.](http://images.novusbio.com/images2/EARS2 Antibody-Immunohistochemistry-Paraffin-NBP1-91856-img0006.jpg)
![Western Blot: DARS Antibody [NBP1-85937] - Analysis using Anti-DARS antibody NBP1-85937 (A) shows similar pattern to independent antibody NBP1-86027 (B).](http://images.novusbio.com/images2/DARS-Antibody-Western-Blot-NBP1-85937-img0012.jpg)
![Immunohistochemistry-Paraffin: DARS Antibody [NBP1-85937] - Staining of human testis.](http://images.novusbio.com/images2/DARS-Antibody-Immunohistochemistry-Paraffin-NBP1-85937-img0015.jpg)
![Western Blot: DARS Antibody [NBP1-85937] - Analysis in human cell line A-431.](http://images.novusbio.com/images2/DARS-Antibody-Western-Blot-NBP1-85937-img0006.jpg)
![Western Blot: Glutamine Synthetase Antibody [NB110-41404] - Analysis of glutamine synthase. 40ug of lysates from mouse (Lanes M), rat (Lane R), pig (Lane P), bovine (Lane B), or human (Lane Hu) retina were probed. A 42 kDa band was identified in lysates from retinas of all species.](http://images.novusbio.com/images2/Glutamine Synthetase Antibody-Western Blot-NB110-41404-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NB110-41404] - Immunofluorescence using NB110-41404. Submitted via verified customer review.](http://images.novusbio.com/images2/Glutamine-Synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NB110-41404-img0006.jpg)
![Immunohistochemistry: Glutamine Synthetase Antibody [NB110-41404] - Localization of glutamine synthase in the retina. Paraffin sections of mouse (A, B), rat (C, D, G-I), or human (E, F) retina fixed in 4% paraformaldehyde were reacted with anti-glutamine synthase (red fluorescence staining in B, D, G, I, and brown immuno-peroxidase reaction. Nuclei in IF experiments (A-D) were stained with DAPI (cyan), and with nuclear fast red in E and F. At low magnification, anti-glutamine synthase reacted with a single population of cells extending from the ganglion cell layer through the inner nuclear layer. No signal was detected in controls either pre-incubated with 100ug/ml of the immunizing peptide (A) or with pre-immune serum (C, E). This finding was confirmed by co-localization (indicated by yellow in I) of glutamine synthase (red in G) with antoher marker of glutamine synthase (green in H).](http://images.novusbio.com/images2/Glutamine Synthetase Antibody-Immunohistochemistry-NB110-41404-img0002.jpg)
![Western Blot: NARS Antibody [NBP2-13640] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/images2/NARS-Antibody-Western-Blot-NBP2-13640-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: NARS Antibody [NBP2-13640] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.](http://images.novusbio.com/images2/NARS-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13640-img0006.jpg)
![Immunohistochemistry-Paraffin: NARS Antibody [NBP2-13640] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/NARS-Antibody-Immunohistochemistry-Paraffin-NBP2-13640-img0010.jpg)
![Western Blot: Tryptophanyl tRNA synthetase Antibody [NBP2-32186] - Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells. Antibodies: Affinity purified rabbit anti-Tryptophanyl tRNA synthetase antibody NBP2-32186 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.](http://images.novusbio.com/images2/Tryptophanyl-tRNA-synthetase-Antibody-Western-Blot-NBP2-32186-img0001.jpg)
![Immunohistochemistry-Paraffin: Tryptophanyl tRNA synthetase Antibody [NBP2-32186] - Serial sections of human lung cancer. Antibody: Affinity purified rabbit anti- WARS used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).](http://images.novusbio.com/images2/Tryptophanyl-tRNA-synthetase-Antibody-Immunohistochemistry-NBP2-32186-img0003.jpg)
![Immunoprecipitation: Tryptophanyl tRNA synthetase Antibody [NBP2-32186] - Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-Tryptophanyl tRNA synthetase antibody NBP2-32186 used for IP at 6 ug per reaction. For blotting immunoprecipitated Tryptophanyl tRNA synthetase, NBP2-32186 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/images2/Tryptophanyl-tRNA-synthetase-Antibody-Immunoprecipitation-NBP2-32186-img0002.jpg)
![Western Blot: WARS2 Antibody [NBP1-54653] - Sample Tissue: Human Fetal Muscle, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12](http://images.novusbio.com/images2/WARS2-Antibody-Western-Blot-NBP1-54653-img0004.jpg)
![Western Blot: WARS2 Antibody [NBP1-54653] - Human Fetal Muscle. Lane A: Primary Antibody. Lane B: Primary Antibody and Blocking Peptide.](http://images.novusbio.com/images2/WARS2-Antibody-Western-Blot-NBP1-54653-img0003.jpg)
![Western Blot: WARS2 Antibody [NBP1-54653] - Human Muscle lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/images2/WARS2-Antibody-Western-Blot-NBP1-54653-img0002.jpg)
![Western Blot: YARS Antibody [NBP1-86889] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-YARS antibody. Remaining relative intensity is presented.](http://images.novusbio.com/images2/YARS-Antibody-Western-Blot-NBP1-86889-img0012.jpg)
![Immunocytochemistry/Immunofluorescence: YARS Antibody [NBP1-86889] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://images.novusbio.com/images2/YARS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86889-img0008.jpg)
![Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86889] - Staining in human cerebral cortex and skeletal muscle tissues using NBP1-86889 antibody. Corresponding YARS RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/YARS-Antibody-Immunohistochemistry-Paraffin-NBP1-86889-img0022.jpg)
![Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in B16F1 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Tyrosinase Antibody (JA52-11)-Immunocytochemistry-Immunofluorescence-NBP2-67232-img0005.jpg)
![Immunohistochemistry-Paraffin: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Analysis of paraffin-embedded human stomach cancer tissue using anti-Tyrosinase antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/Tyrosinase-Antibody-(JA52-11)-Immunohistochemistry-Paraffin-NBP2-67232-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in A431 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Tyrosinase-Antibody-(JA52-11)-Immunocytochemistry-Immunofluorescence-NBP2-67232-img0001.jpg)
![Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining in human adrenal gland and liver tissues using anti-QPCT antibody. Corresponding QPCT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Immunohistochemistry-Paraffin-NBP1-81838-img0010.jpg)
![Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in control (vector only transfected HEK293T lysate) and QPCT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Western-Blot-NBP1-81838-img0011.jpg)
![Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Western-Blot-NBP1-81838-img0006.jpg)
![Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in human testis and skeletal muscle tissues using NBP1-87730 antibody. Corresponding Methionyl tRNA synthetase RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Methionyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-87730-img0016.jpg)
![Western Blot: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MARS antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/images2/Methionyl-tRNA-synthetase-Antibody-Western-Blot-NBP1-87730-img0015.jpg)
![Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/Methionyl-tRNA-synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87730-img0012.jpg)
![Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments & aggresome.](http://images.novusbio.com/images2/Methionyl tRNA synthetase 2 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92106-img0007.jpg)
![Immunohistochemistry-Paraffin: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.](http://images.novusbio.com/images2/Methionyl-tRNA-synthetase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92106-img0002.jpg)
![Western Blot: DARS2 Antibody [NBP1-83854] - Analysis using Anti-DARS2 antibody NBP1-83854 (A) shows similar pattern to independent antibody NBP1-83855 (B).](http://images.novusbio.com/images2/DARS2-Antibody-Western-Blot-NBP1-83854-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: DARS2 Antibody [NBP1-83854] - Staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.](http://images.novusbio.com/images2/DARS2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83854-img0007.jpg)
![Immunohistochemistry-Paraffin: DARS2 Antibody [NBP1-83854] - Staining of human lymph node.](http://images.novusbio.com/images2/DARS2-Antibody-Immunohistochemistry-Paraffin-NBP1-83854-img0012.jpg)
![Western Blot: NARS2 Antibody [NBP1-82077] - Analysis in human cell line K562.](http://images.novusbio.com/images2/NARS2-Antibody-Western-Blot-NBP1-82077-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: NARS2 Antibody [NBP1-82077] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/images2/NARS2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82077-img0008.jpg)
![Immunohistochemistry-Paraffin: NARS2 Antibody [NBP1-82077] - Staining of human kidney shows strong cytoplasmic positivity with a granular pattern in tubule cells.](http://images.novusbio.com/images2/NARS2-Antibody-Immunohistochemistry-Paraffin-NBP1-82077-img0002.jpg)
![Western Blot: YARS2 Antibody [NBP2-20928] - Sample (30 ug of whole cell lysate) A: NT2D1 10% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/YARS2 Antibody-Western Blot-NBP2-20928-img0001.jpg)
![Immunohistochemistry-Paraffin: YARS2 Antibody [NBP2-20928] - Human colon carcinoma, using YARS2 antibody at 1:250 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min](http://images.novusbio.com/images2/YARS2 Antibody-Immunohistochemistry-Paraffin-NBP2-20928-img0002.jpg)
![Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.](http://images.novusbio.com/images2/GLYAT-Antibody-Western-Blot-NBP2-58917-img0002.jpg)
![Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human skeletal muscle.](http://images.novusbio.com/images2/GLYAT Antibody-Immunohistochemistry-Paraffin-NBP2-58917-img0010.jpg)
![Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.](http://images.novusbio.com/images2/GLYAT-Antibody-Immunohistochemistry-Paraffin-NBP2-58917-img0004.jpg)
![Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/CRAT-Antibody-Immunohistochemistry-Paraffin-NBP1-86616-img0014.jpg)
![Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).](http://images.novusbio.com/images2/CRAT-Antibody-Western-Blot-NBP1-86616-img0011.jpg)
![Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.](http://images.novusbio.com/images2/CRAT-Antibody-Western-Blot-NBP1-86616-img0010.jpg)
![Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.](http://images.novusbio.com/images2/Catalase-Antibody-Western-Blot-NBP2-24916-img0001.jpg)
![Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.](http://images.novusbio.com/images2/Catalase-Antibody-Immunohistochemistry-Paraffin-NBP2-24916-img0002.jpg)
![Western Blot: ArgRS Antibody [NBP2-92835] - Analysis of extracts of various cell lines, using RARS2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane._Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 90s.](http://images.novusbio.com/images2/ArgRS Antibody-Western Blot-NBP2-92835-img0002.jpg)
![Immunohistochemistry-Paraffin: ArgRS Antibody [NBP2-92835] - Mouse stomach using RARS2 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/images2/ArgRS-Antibody-Immunohistochemistry-Paraffin-NBP2-92835-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")