QARS Antibody

Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human cerebral cortex, colon, liver and testis using Anti-QARS antibody NBP1-89487 (A) shows similar protein distribution across tissues to independent antibody NBP2-37883 (B).

Western Blot: QARS Antibody [NBP1-89487] - Analysis using Anti-QARS antibody NBP1-89487 (A) shows similar pattern to independent antibody NBP2-37883 (B).

Immunocytochemistry/Immunofluorescence: QARS Antibody [NBP1-89487] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human cerebral cortex.

Western Blot: QARS Antibody [NBP1-89487] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human liver.

Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human colon.

Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human testis.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

QARS Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: QARS1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  QARS Protein (NBP1-89487PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for QARS Antibody

• EC 6.1.1
• EC 6.1.1.18
• GLNRS
• glutamine tRNA ligase
• Glutamine--tRNA ligase
• glutamine-tRNA synthetase
• glutaminyl-tRNA synthetase
• PRO2195

Background

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. In metazoans, 9 aminoacyl-tRNA synthetases specific for glutamine (gln), glutamic acid (glu), and 7 other amino acids are associated within a multienzyme complex. Although present in eukaryotes, glutaminyl-tRNA synthetase (QARS) is absent from many prokaryotes, mitochondria, and chloroplasts, in which Gln-tRNA(Gln) is formed by transamidation of the misacylated Glu-tRNA(Gln). Glutaminyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for QARS Antibody (NBP1-89487)(1)

Publication using NBP1-89487

• Kong J, Kim S Cell-based analysis of pairwise interactions between the components of the multi-tRNA synthetase complex FASEB J. 2020-06-15 [PMID: 32539228] (WB, Human)

Bioinformatics

• Gene Symbol: QARS1