QARS Antibody

Images

 
Independent Antibodies: Western Blot: QARS Antibody [NBP1-89487] - Analysis using Anti-QARS antibody NBP1-89487 (A) shows similar pattern to independent antibody NBP2-37883 (B).
Immunocytochemistry/ Immunofluorescence: QARS Antibody [NBP1-89487] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human cerebral cortex.
Western Blot: QARS Antibody [NBP1-89487] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Independent Antibodies: Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human cerebral cortex, colon, liver and testis using Anti-QARS antibody NBP1-89487 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human liver.
Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human colon.
Immunohistochemistry-Paraffin: QARS Antibody [NBP1-89487] - Staining of human testis.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

QARS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDA
Specificity
Specificity of human, mouse, rat QARS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
QARS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
QARS Protein (NBP1-89487PEP)
Publications
Read Publication using
NBP1-89487 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for QARS Antibody

  • EC 6.1.1
  • EC 6.1.1.18
  • GLNRS
  • glutamine tRNA ligase
  • Glutamine--tRNA ligase
  • glutamine-tRNA synthetase
  • glutaminyl-tRNA synthetase
  • PRO2195

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P, KD
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32186
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-54653
Species: Hu
Applications: WB
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-92106
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83854
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82077
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-92835
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for QARS Antibody (NBP1-89487)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for QARS Antibody (NBP1-89487) (0)

There are no reviews for QARS Antibody (NBP1-89487). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for QARS Antibody (NBP1-89487) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional QARS Products

Bioinformatics Tool for QARS Antibody (NBP1-89487)

Discover related pathways, diseases and genes to QARS Antibody (NBP1-89487). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for QARS Antibody (NBP1-89487)

Discover more about diseases related to QARS Antibody (NBP1-89487).
 

Pathways for QARS Antibody (NBP1-89487)

View related products by pathway.

Blogs on QARS

There are no specific blogs for QARS, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our QARS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol QARS1