VRL1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: VRL1 Antibody [NBP1-92576] - Staining of human cell line SK-MEL-30 shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: VRL1 Antibody [NBP1-92576] - Staining of human gastrointestinal shows strong cytoplasmic positivity in peripheral ganglion.

Immunohistochemistry-Paraffin: VRL1 Antibody [NBP1-92576] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: VRL1 Antibody [NBP1-92576] - Staining of human placenta shows strong cytoplasmic positivity in endothelial cells.

Immunohistochemistry-Paraffin: VRL1 Antibody [NBP1-92576] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Staining of human cell line SK-MEL-30 shows localization to plasma membrane.

Staining of human placenta shows strong cytoplasmic positivity in endothelial cells.

Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VRL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VRL1 Antibody - BSA Free (NBP1-92576) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-VRL1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRPV2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  VRL1 Protein (NBP1-92576PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for VRL1 Antibody - BSA Free

• Osm-9-like TRP channel 2
• OTRPC2
• transient receptor potential cation channel, subfamily V, member 2
• TrpV2
• Vanilloid receptor-like protein 1
• VRL
• VRL1
• VRL-1
• VRL-1MGC12549
• VRL1transient receptor potential cation channel subfamily V member 2
• VRLOTRPC2

Background

Caterina et al has identified a structurally related receptor, VRL-1, that does not respond to capsaicin, acid or moderate heat. Instead, VRL-1 is activated by high temperatures, with a threshold of approximately 52 degrees C. Within sensory ganglia, VRL-1 is most prominently expressed by a subset of medium- to large-diameter neurons, making it a candidate receptor for transducing high-threshold heat responses in this class of cells. VRL-1 transcripts are not restricted to the sensory nervous system, indicating that this channel may be activated by stimuli other than heat. VRL-1 is one of the six members of the vanilloid-like TRP-channel family which is now known as TRPV family. FUNCTION: Calcium-permeable, non-selective cation channel with an outward rectification. Seems to be regulated, at least in part, by growth factors, like IGF1, PDGF and morphogenetic neuropeptide/head activator. May transduce physical stimuli in mast cells. Activated by temperatures higher than 52 degrees Celsius; is not activated by vanilloids and acidic pH. SUBUNIT: Homotetramer (Probable). Interacts with a cAMP-dependent protein kinase type II regulatory subunit (PRKAR2A or PRKAR2B) and ACBD3. Interacts with RGA. SUBCELLULAR LOCATION: Cell membrane; multi-pass membrane protein. Cytoplasm. Translocates from the cytoplasm to the plasma membrane upon ligand stimulation. TISSUE SPECIFICITY: Ubiquitously expressed. Expressed in dorsal root ganglia, trigeminal ganglia, spinal chord (Lissauer's tract, dorsal horn and dorsal columns) (at protein level). PTM: N-glycosylated. PTM: Phosphorylated by PKA. SIMILARITY: Belongs to the transient receptor family. TrpV subfamily. SIMILARITY: Contains 3 ANK repeats.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VRL1 Antibody (NBP1-92576)(2)

Publications using NBP1-92576

• Urushima H, Matsubara T, Miyakoshi M et al. Hypo-osmolarity induces apoptosis resistance via TRPV2-mediated AKT-Bcl-2 pathway American journal of physiology. Gastrointestinal and liver physiology 2023-03-01 [PMID: 36719093]
• Koya-Miyata S, Kohno K, Morimoto T et al. [Inhibition of TRPV2 Channel Activation by NK-4, a Cryptocyanine Dye] yakugaku zasshi : Journal of the Pharmaceutical Society of Japan 2022-02-28 [PMID: 35228454] (WB, ICC/IF, Human)

Bioinformatics

• Gene Symbol: TRPV2