VRK1 Antibody - BSA Free

Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-VRK1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VRK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VRK1 Antibody - BSA Free (NBP1-85822) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-VRK1 Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKI
• Predicted Species: Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VRK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Control Peptide:

  VRK1 Protein (NBP1-85822PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for VRK1 Antibody - BSA Free

• EC 2.7.11.1
• MGC117401
• MGC138280
• MGC142070
• PCH1
• serine/threonine-protein kinase VRK1
• vaccinia related kinase 1
• vaccinia virus B1R-related kinase 1
• Vaccinia-related kinase 1
• VRK1

Background

VRK1 encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VRK1 Antibody (NBP1-85822)(6)

Publications using NBP1-85822

• Cantarero L, Sanz-Garcia M, Vinograd-Byk H et al. VRK1 regulates Cajal body dynamics and protects coilin from proteasomal degradation in cell cycle. Sci Rep 2015-06-12 [PMID: 26068304] (ICC/IF, Human)
• Salzano M, Vazquez-Cedeira M, Sanz-Garcia M et al. Vaccinia-related kinase 1 (VRK1) confers resistance to DNA-damaging agents in human breast cancer by affecting DNA damage response. Oncotarget 2014-04-15 [PMID: 24731990] (IF/IHC, Human)
• Molitor TP, Traktman P. Depletion of the protein kinase VRK1 disrupts nuclear envelope morphology and leads to BAF retention on mitotic chromosomes. Mol Biol Cell 2014-03-01 [PMID: 24430874] (ICC/IF, WB, Human)
• Molitor TP, Traktman P. Molecular genetic analysis of VRK1 in mammary epithelial cells: depletion slows proliferation in vitro and tumor growth and metastasis in vivo. Oncogenesis 2013-06-03 [PMID: 23732708] (WB, Human)
• Kim IJ, Quigley D, To MD et al. Rewiring of human lung cell lineage and mitotic networks in lung adenocarcinomas. Nat Commun 2013-01-01 [PMID: 23591868]
• Sanz-Garcia M, Monsalve DM, Sevilla A et al. Vaccinia-related Kinase 1 (VRK1) Is an Upstream Nucleosomal Kinase Required for the Assembly of 53BP1 Foci in Response to Ionizing Radiation-induced DNA Damage. J Biol Chem 2012-07-06 [PMID: 22621922]

Bioinformatics

• Gene Symbol: VRK1
• Uniprot:
  • Q99986()