VPS54 Antibody - BSA Free

Western Blot: VPS54 Antibody [NBP1-56818] - Human Stomach, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

VPS54 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to VPS54(vacuolar protein sorting 54 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS54. Peptide sequence FNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVNIAHQISLRS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VPS54
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for VPS54 Antibody - BSA Free

• HCC8SLP-8p
• Hepatocellular carcinoma protein 8
• hVps54L
• Tumor antigen HOM-HCC-8
• Tumor antigen SLP-8p
• vacuolar protein sorting 54 (yeast)
• vacuolar protein sorting 54 homolog (S. cerevisiae)
• vacuolar protein sorting-associated protein 54
• VPS54L

Background

VPS54 may be involved in retrograde transport from early and late endosomes to late Golgi. This gene encodes for a protein that in yeast forms part of a trimeric vacuolar-protein-sorting complex that is required for retrograde transport of proteins from prevacuoles to the late Golgi compartment. As in yeast, mammalian Vps54 proteins contain a coiled-coil region and dileucine motifs. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VPS54
• Uniprot:
  • Q9P1Q0(Human)