VPS34 Antibody - BSA Free

Images

 
Western Blot: VPS34 Antibody [NBP2-94870] - Analysis of extracts of various cell lines, using VPS34 at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Immunocytochemistry/ Immunofluorescence: VPS34 Antibody - BSA Free [NBP2-94870] - Immunofluorescence analysis of PC-12 cells using VPS34 antibody (A4021) at dilution of 1:100. Blue: DAPI for nuclear staining.

Product Details

Summary
Product Discontinued
View other related VPS34 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-94870
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

VPS34 Antibody - BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human VPS34 (NP_002638.2). EADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIK3C3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:200-1:2000
Theoretical MW
101 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for VPS34 Antibody - BSA Free

  • EC 2.7.1
  • EC 2.7.1.137
  • hVps34
  • MGC61518
  • phosphatidylinositol 3-kinase catalytic subunit type 3
  • Phosphatidylinositol 3-kinase p100 subunit
  • Phosphoinositide-3-kinase class 3
  • phosphoinositide-3-kinase, class 3
  • PI 3-Kinase C3
  • PI3K type 3
  • PI3-kinase type 3
  • PIK3C3
  • PtdIns-3-kinase type 3
  • VPS34

Background

VPS34, also known as phosphoinositide-3-kinase p100 subunit or PIK3C3 (phosphoinositide-3-kinase, class III), is a member of the PI3/PI4-kinase family. It is ubiquitously expressed with predominant expression in skeletal muscle and is believed to participate in endosome to lysosome transport, multivesicular body formation, autophagy and retrograde endosome to Golgi transport. VPS34 is the catalytic subunit of class III PI3Ks and forms a heterodimer with p150, a regulatory subunit of class 3 PI3Ks. It exclusively phosphorylates phosphatidylinositol to produce PtdIns3P. The activity of VPS34 is enhanced by manganese and can be regulated by nutrients, suggesting an important role of VPS34 in the regulation of mTOR protein synthesis. VPS34 also forms a complex with Beclin1 that promotes autophagy and tumor supression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-249
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-30463
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IP, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-18885
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB300-949
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-36568
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
MAB6608
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
AF5414
Species: Hu
Applications: Simple Western, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
H00008518-M03
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB500-207
Species: Hu
Applications: ICC/IF, IP, WB

Publications for VPS34 Antibody (NBP2-94870) (0)

There are no publications for VPS34 Antibody (NBP2-94870).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS34 Antibody (NBP2-94870) (0)

There are no reviews for VPS34 Antibody (NBP2-94870). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VPS34 Antibody (NBP2-94870) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPS34 Products

Research Areas for VPS34 Antibody (NBP2-94870)

Find related products by research area.

Blogs on VPS34. Showing 1-10 of 12 blog posts - Show all blog posts.

Autophagy Research Update: What a difference a year makes!
By Christina Towers, PhD Over the last two decades the field of autophagy has exploded! Innovative techniques, comprehensive analysis and disease-relevant models have yielded basic and clinical discoveries of conseque...  Read full blog post.

Animal Models to Study Autophagy
By Christina Towers, PhD What is autophagy?Autophagy is the catabolic process that degrades cytoplasmic material via the lysosome. The process of macroautophagy was originally characterized in yeast, where the...  Read full blog post.


  Read full blog post.

E-syt in Autophagosome biogenesis: What is the source of it all?
By Christina Towers, PhD. Macroautophagy is a cellular recycling process that requires the formation of double membrane structures to engulf and degrade damaged cytoplasmic material. The pathway involves over 20 co...  Read full blog post.

Lysosomal Dysfunction is Linked to Exosomal Secretion
By Christina Towers, PhD. Lysosomal Dysfunction and DiseaseLysosomes are highly acidic organelles that are critical for cellular function and indispensable for degradative pathways like autophagy and endocytosis....  Read full blog post.

UVRAG - A regulator of membrane trafficking in autophagy and endocytosis
UV resistance-associated gene (UVRAG) is a tumor suppressor that is commonly mutated in colon and breast cancer. While UVRAG was discovered for its ability to complement UV sensitivity in xeroderma pigmentosum cells, its main functions are in auto...  Read full blog post.

VPS34 - autophagy initiator and regulator of endosomal trafficking
VPS34, vacuolar protein sorting 34, is the only identified Class III phosphoinositide-3 kinase (PI3K) in mammals and is ubiquitously expressed in all eukaryotic cells. VPS34 is a 100 kDa protein responsible for phosphorylating phosphatidylinositol...  Read full blog post.

ULK1 - mammalian homologue of the yeast ATG1 kinase
Autophagy is an important cellular process involved in degradation and recycling of cellular macromolecules in response to stress or starvation. Autophagy is carried out in four main phases: phagophore nucleation, autophagosome elongation, docking...  Read full blog post.

VPS41 - An important regulator of lysosomal trafficking
Membrane fusion is an essential step during the trafficking of endosomes and vesicles throughout the cell. Membrane fusion events are facilitated by multisubunit tethering complexes (MTC) including CORVET and HOPS. These complexes interact with Rab...  Read full blog post.

Beclin 2, a mammal-specific homolog of Beclin 1 with unique functional similarities and differences
Beclin 2 (BECN2) is also called Beclin-1-like protein 1/ BECN1P1 and it was recently identified by He et al 2013 as a mammal-specific homolog of the evolutionarily conserved protein Beclin 1 which is well established for its role in the regulation ...  Read full blog post.

Showing 1-10 of 12 blog posts - Show all blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS34 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3C3