VPS28 Antibody

Images

 
Western Blot: VPS28 Antibody [NBP1-85976] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: VPS28 Antibody [NBP1-85976] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Western Blot: VPS28 Antibody [NBP1-85976] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-627

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS28 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAACS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS28
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VPS28 Protein (NBP1-85976PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VPS28 Antibody

  • ESCRT-I complex subunit VPS28
  • H-Vps28
  • MGC60323
  • vacuolar protein sorting 28 (yeast)
  • vacuolar protein sorting 28 homolog (S. cerevisiae)
  • vacuolar protein sorting-associated protein 28 homolog
  • yeast class E protein Vps28p homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP1-82283
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DDX0390P-100
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo
NBP1-83528
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91882
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NBP2-13519
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83632
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VPS28 Antibody (NBP1-85976) (0)

There are no publications for VPS28 Antibody (NBP1-85976).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS28 Antibody (NBP1-85976) (0)

There are no reviews for VPS28 Antibody (NBP1-85976). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS28 Antibody (NBP1-85976) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPS28 Products

Bioinformatics Tool for VPS28 Antibody (NBP1-85976)

Discover related pathways, diseases and genes to VPS28 Antibody (NBP1-85976). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS28 Antibody (NBP1-85976)

Discover more about diseases related to VPS28 Antibody (NBP1-85976).
 

Pathways for VPS28 Antibody (NBP1-85976)

View related products by pathway.

PTMs for VPS28 Antibody (NBP1-85976)

Learn more about PTMs related to VPS28 Antibody (NBP1-85976).
 

Research Areas for VPS28 Antibody (NBP1-85976)

Find related products by research area.

Blogs on VPS28

There are no specific blogs for VPS28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS28 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS28