Recombinant Human Vitrin Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Vitrin Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 203 of Human VIT full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRTVVLTMKASVIEMFLVLLVTGVHSNKETAKKIKRPKFTVPQINCDVKAGKIIDPEFIVKCPAGCQDPKYHVYGTDVYASYSSVCGAAVHSGVLDNSGGKILVRKVAGQSGYKGSYSNGVQSLSLPRWRESFIVLESKPKKGVTYPSALTYSSSKSPAAQAGKCSRVIESKPSESMNTRRVLGDSGEINILTGQAPLALAIF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
VIT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
48.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Vitrin Protein

  • DKFZp313L1517
  • MGC149746
  • MGC70561
  • vitrin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-35216
Species: Hu
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
NB100-2307
Species: Hu
Applications: WB
NBP2-24940
Species: Hu, Ye
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB110-61574
Species: Hu, Mu, Bv, Gt, Sh
Applications: WB
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P

Publications for Vitrin Recombinant Protein (H00005212-P01) (0)

There are no publications for Vitrin Recombinant Protein (H00005212-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vitrin Recombinant Protein (H00005212-P01) (0)

There are no reviews for Vitrin Recombinant Protein (H00005212-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vitrin Recombinant Protein (H00005212-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Vitrin Products

Vitrin H00005212-P01

Bioinformatics Tool for Vitrin Recombinant Protein (H00005212-P01)

Discover related pathways, diseases and genes to Vitrin Recombinant Protein (H00005212-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vitrin Recombinant Protein (H00005212-P01)

Discover more about diseases related to Vitrin Recombinant Protein (H00005212-P01).
 

Pathways for Vitrin Recombinant Protein (H00005212-P01)

View related products by pathway.

PTMs for Vitrin Recombinant Protein (H00005212-P01)

Learn more about PTMs related to Vitrin Recombinant Protein (H00005212-P01).

Blogs on Vitrin

There are no specific blogs for Vitrin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Vitrin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VIT