VGF Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: VGF Antibody [NBP2-31596] - Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.
Immunohistochemistry-Paraffin: VGF Antibody [NBP2-31596] - Staining of human pituitary gland shows strong cytoplasmic positivity in anterior cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VGF Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: APARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRPRTLQPPSALRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQEELENYIEHV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VGF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VGF Recombinant Protein Antigen (NBP2-31596PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VGF Antibody

  • neuro-endocrine specific protein VGF
  • neurosecretory protein VGF
  • VGF nerve growth factor inducible
  • VGF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00027344-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-31596
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for VGF Antibody (NBP2-31596) (0)

There are no publications for VGF Antibody (NBP2-31596).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VGF Antibody (NBP2-31596) (0)

There are no reviews for VGF Antibody (NBP2-31596). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for VGF Antibody (NBP2-31596) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VGF Products

Bioinformatics Tool for VGF Antibody (NBP2-31596)

Discover related pathways, diseases and genes to VGF Antibody (NBP2-31596). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VGF Antibody (NBP2-31596)

Discover more about diseases related to VGF Antibody (NBP2-31596).
 

Pathways for VGF Antibody (NBP2-31596)

View related products by pathway.

PTMs for VGF Antibody (NBP2-31596)

Learn more about PTMs related to VGF Antibody (NBP2-31596).

Blogs on VGF

There are no specific blogs for VGF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VGF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VGF
Entrez
Uniprot