PCSK1N Antibody

Images

 
Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human pancreas shows cytoplasmic positivity in endocrine cells.
Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human anterior pituitary gland shows strong cytoplasmic positivity in a subset of endocrine cells.
Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining in human cerebral cortex and tonsil tissues using anti-PCSK1N antibody. Corresponding PCSK1N RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCSK1N Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AETGAPRRFRRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVP
Specificity
Specificity of human PCSK1N antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCSK1N
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PCSK1N Protein (NBP1-80797PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCSK1N Antibody

  • granin-like neuroendocrine peptide
  • Proprotein convertase 1 inhibitor
  • proprotein convertase subtilisin/kexin type 1 inhibitorPROSAAS
  • proSAAS
  • pro-SAAS
  • SAAS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-38536
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90944
Species: Hu
Applications: WB, IHC, IHC-P, PAGE
NBP2-31596
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-65110
Species: Hu
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-90312
Species: Hu
Applications: IHC, IHC-P
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PCSK1N Antibody (NBP1-80797) (0)

There are no publications for PCSK1N Antibody (NBP1-80797).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCSK1N Antibody (NBP1-80797) (0)

There are no reviews for PCSK1N Antibody (NBP1-80797). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PCSK1N Antibody (NBP1-80797) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PCSK1N Antibody (NBP1-80797)

Discover related pathways, diseases and genes to PCSK1N Antibody (NBP1-80797). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCSK1N Antibody (NBP1-80797)

Discover more about diseases related to PCSK1N Antibody (NBP1-80797).
 

Pathways for PCSK1N Antibody (NBP1-80797)

View related products by pathway.

PTMs for PCSK1N Antibody (NBP1-80797)

Learn more about PTMs related to PCSK1N Antibody (NBP1-80797).

Blogs on PCSK1N

There are no specific blogs for PCSK1N, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCSK1N Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCSK1N