VEZF1 Antibody

Images

 
Western Blot: VEZF1 Antibody [NBP1-84301] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-2 OS
Immunocytochemistry/ Immunofluorescence: VEZF1 Antibody [NBP1-84301] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: VEZF1 Antibody [NBP1-84301] - Staining of human kidney shows weak nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VEZF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RLWEEAVKARKKEAANLCQTSTAATTPVTLTTPFSITSSVSSGTMSNPVTVAAAMSMRSPVNVSSAVNITSPMNIGHPVTITSPLSMTSPLTLTTPVNLPTPVTAPVNIAHPVTITSPMNLPTPMTLAAPLNIAMRPVES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VEZF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VEZF1 Protein (NBP1-84301PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VEZF1 Antibody

  • DB1
  • putative transcription factor DB1
  • vascular endothelial zinc finger 1
  • zinc finger protein 161
  • ZNF161

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-41169
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00007541-M02
Species: Hu
Applications: WB, ELISA
NB100-266
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-52911
Species: Hu
Applications: WB, IHC, IHC-P
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-84301
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VEZF1 Antibody (NBP1-84301) (0)

There are no publications for VEZF1 Antibody (NBP1-84301).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VEZF1 Antibody (NBP1-84301) (0)

There are no reviews for VEZF1 Antibody (NBP1-84301). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VEZF1 Antibody (NBP1-84301) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VEZF1 Products

Bioinformatics Tool for VEZF1 Antibody (NBP1-84301)

Discover related pathways, diseases and genes to VEZF1 Antibody (NBP1-84301). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VEZF1 Antibody (NBP1-84301)

Discover more about diseases related to VEZF1 Antibody (NBP1-84301).
 

Pathways for VEZF1 Antibody (NBP1-84301)

View related products by pathway.

PTMs for VEZF1 Antibody (NBP1-84301)

Learn more about PTMs related to VEZF1 Antibody (NBP1-84301).

Blogs on VEZF1

There are no specific blogs for VEZF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VEZF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VEZF1