VEGFR3/Flt-4 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YKCVVSNKVGQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLLDCK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FLT4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for VEGFR3/Flt-4 Antibody - BSA Free
Background
FLT4, a VEGF Receptor type protein kinase, is an endothelial cell-specific receptor. Binding of the extracellular domain of FLT4 to the vascular endothelial growth factor-related protein VEGF-C stimulates tyrosine phosphorylation and mitogenesis of endothelial cells. FLT4 (-/-) mice have been shown to have defective blood vessel development in early embryos and to experience cardiovascular failure at embryonic day 9.5. A mutation in the FLT4 gene has been implicated in human hereditary lymphedema type I. Similarly, a mutation in the conserved catalytic domain of FLT4, in close proximity to the FLT4 mutations in human primary lymphedema, has been linked to the Chy mouse mutant.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Rt
Applications: IHC, WB
Publications for VEGFR3/Flt-4 Antibody (NBP3-21370) (0)
There are no publications for VEGFR3/Flt-4 Antibody (NBP3-21370).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VEGFR3/Flt-4 Antibody (NBP3-21370) (0)
There are no reviews for VEGFR3/Flt-4 Antibody (NBP3-21370).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for VEGFR3/Flt-4 Antibody (NBP3-21370) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VEGFR3/Flt-4 Products
Research Areas for VEGFR3/Flt-4 Antibody (NBP3-21370)
Find related products by research area.
|
Blogs on VEGFR3/Flt-4