VEGFR3/Flt-4 Antibody - BSA Free

Staining of human placenta shows cytoplasmic positivity in endothelial cells and trophoblastic cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VEGFR3/Flt-4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YKCVVSNKVGQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLLDCK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FLT4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for VEGFR3/Flt-4 Antibody - BSA Free

• EC 2.7.10
• EC 2.7.10.1
• FLT4
• Flt-4
• fms-related tyrosine kinase 4
• LMPH1A
• PCLFLT41
• soluble VEGFR3 variant 1
• soluble VEGFR3 variant 2
• soluble VEGFR3 variant 3
• Tyrosine-protein kinase receptor FLT4
• vascular endothelial growth factor receptor 3
• VEGF R3
• VEGFR3
• VEGFR-3
• VEGFR3Fms-like tyrosine kinase 4

Background

FLT4, a VEGF Receptor type protein kinase, is an endothelial cell-specific receptor. Binding of the extracellular domain of FLT4 to the vascular endothelial growth factor-related protein VEGF-C stimulates tyrosine phosphorylation and mitogenesis of endothelial cells. FLT4 (-/-) mice have been shown to have defective blood vessel development in early embryos and to experience cardiovascular failure at embryonic day 9.5. A mutation in the FLT4 gene has been implicated in human hereditary lymphedema type I. Similarly, a mutation in the conserved catalytic domain of FLT4, in close proximity to the FLT4 mutations in human primary lymphedema, has been linked to the Chy mouse mutant.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FLT4