VDAC3 Antibody - BSA Free

Western Blot: VDAC3 Antibody [NBP1-80069] - RPMI-8226, Antibody Dilution: 1.0 ug/ml.

Western Blot: VDAC3 Antibody [NBP1-80069] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Western Blot: VDAC3 Antibody [NBP1-80069] - HT1080, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

VDAC3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human VDAC3. Peptide sequence: SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VDAC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for VDAC3 Antibody - BSA Free

• HD-VDAC3
• hVDAC3
• Outer mitochondrial membrane protein porin 3
• VDAC-3
• voltage-dependent anion channel 3
• voltage-dependent anion-selective channel protein 3

Background

The Voltage-Dependant Anion Channel (VDAC3) of the outer mitochondrial membrane, a small abundant protein found in all eukaryotic kingdoms, forms a voltage-gated pore when incorporated into planar lipid bilayers. VDAC is also the site of binding of the metabolic enzymes hexokinase and glycerol kinase to the mitochondrion in what may be a significant metabolic regulatory interaction. VDAC3 is involved specifically in translocation of adenine nucleotides through the outer membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VDAC3 Antibody (NBP1-80069)(1)

Publication using NBP1-80069

• Tanno M, Kuno A, Ishikawa S et al. Translocation of GSK-3b, a Trigger of Permeability Transition, Is Kinase Activity-dependent and Mediated by Interaction with VDAC2. J Biol Chem. 2014-09-03 [PMID: 25187518]

Bioinformatics

• Gene Symbol: VDAC3
• Uniprot:
  • NP_005653(Human)