![Immunocytochemistry/Immunofluorescence: Utrophin Antibody [NBP1-84074] - Staining of human cell line U-251 MG shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/Utrophin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84074-img0010.jpg "Immunocytochemistry/Immunofluorescence: Utrophin Antibody [NBP1-84074] - Staining of human cell line U-251 MG shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GELDKQLTTYLTDRIDAFQVPQEAQKIQAEISAHELTLEELRRNMRSQPLTSPESRTARGGSQMDVLQRKLREVSTKFQLFQKPANFEQRMLDCKRVLDGVKAELHVLDVKDVDPDVIQTHLDKCMKLYKTLSEVKLEVETVI |
| Predicted Species | Mouse (92%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UTRN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Flow-Cytometry-NB100-56503-img0011.jpg)
-Flow-(Intracellular)-NB100-56503-img0014.jpg)
-Western-Blot-NB100-56503-img0015.jpg)
-Western-Blot-NBP1-28566-img0005.jpg)
-Western-Blot-NBP1-28566-img0007.jpg)
-Immunohistochemistry-Frozen-NBP1-28566-img0002.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for Utrophin Antibody (NBP1-84074)Discover more about diseases related to Utrophin Antibody (NBP1-84074).
| Pathways for Utrophin Antibody (NBP1-84074)View related products by pathway.
|
PTMs for Utrophin Antibody (NBP1-84074)Learn more about PTMs related to Utrophin Antibody (NBP1-84074).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UTRN |
![Immunohistochemistry-Paraffin: Utrophin Antibody [NBP1-84074] - Staining of human liver shows no membranous positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize2/Utrophin-Antibody-Immunohistochemistry-Paraffin-NBP1-84074-img0009.jpg "Immunohistochemistry-Paraffin: Utrophin Antibody [NBP1-84074] - Staining of human liver shows no membranous positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Utrophin Antibody [NBP1-84074] - Staining of human prostate shows moderate to strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/Utrophin-Antibody-Immunohistochemistry-Paraffin-NBP1-84074-img0006.jpg "Immunohistochemistry-Paraffin: Utrophin Antibody [NBP1-84074] - Staining of human prostate shows moderate to strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Utrophin Antibody [NBP1-84074] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli and cells in tubules.](http://images.novusbio.com/fullsize2/Utrophin-Antibody-Immunohistochemistry-Paraffin-NBP1-84074-img0007.jpg "Immunohistochemistry-Paraffin: Utrophin Antibody [NBP1-84074] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli and cells in tubules.")
![Immunohistochemistry-Paraffin: Utrophin Antibody [NBP1-84074] - Staining of human stomach shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/Utrophin-Antibody-Immunohistochemistry-Paraffin-NBP1-84074-img0008.jpg "Immunohistochemistry-Paraffin: Utrophin Antibody [NBP1-84074] - Staining of human stomach shows moderate membranous positivity in glandular cells.")
![Immunohistochemistry Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Immunohistochemistry_11019.jpg)
![Western Blot Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Western_Blot_11065.jpg)
![Knockout Validated Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Knockout_Validated_23118.jpg)
-Western-Blot-H00009927-M03-img0004.jpg)
-Immunohistochemistry-Paraffin-H00009927-M03-img0007.jpg)
-Western-Blot-H00009927-M03-img0008.jpg)
-Western-Blot-H00055669-M04-img0001.jpg)
-Western-Blot-H00055669-M04-img0003.jpg)
-Western-Blot-H00055669-M04-img0006.jpg)
![Agrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Agrin [Unconjugated]")
-Immunohistochemistry-Paraffin-NBP2-67150-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP2-67150-img0002.jpg)
-Immunohistochemistry-Frozen-NBP2-67150-img0005.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")