Novus Biologicals products are now on bio-techne.com

Utrophin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Utrophin Antibody [NBP1-84074] - Staining of human cell line U-251 MG shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Utrophin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GELDKQLTTYLTDRIDAFQVPQEAQKIQAEISAHELTLEELRRNMRSQPLTSPESRTARGGSQMDVLQRKLREVSTKFQLFQKPANFEQRMLDCKRVLDGVKAELHVLDVKDVDPDVIQTHLDKCMKLYKTLSEVKLEVETVI
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UTRN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Utrophin Protein (NBP1-84074PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Utrophin Antibody

  • DMDLutrophin (homologous to dystrophin)
  • DRP
  • DRP1DRP-1
  • Dystrophin-related protein 1
  • FLJ23678
  • utrophin

Background

UTRN - utrophin (homologous to dystrophin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB110-55288
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AF6868
Species: Hu
Applications: IHC, KO, WB
NBP1-85664
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00009927-M03
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, RNAi, WB
H00055669-M04
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IP, KD, WB
NBP1-39681
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC, IHC-P, IP, WB
550-AG
Species: Rt
Applications: BA, BA
NB110-55290
Species: Ch, Hu, Mu, Po, Rt, Ze
Applications: IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-2357
Species: Hu, Mu, Pm
Applications: ChIP, IHC, IHC-P, IP, WB
NBP2-16229
Species: Mu
Applications: WB
NBP3-15896
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-31762
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NBP1-85537
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Utrophin Antibody (NBP1-84074) (0)

There are no publications for Utrophin Antibody (NBP1-84074).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Utrophin Antibody (NBP1-84074) (0)

There are no reviews for Utrophin Antibody (NBP1-84074). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Utrophin Antibody (NBP1-84074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Utrophin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UTRN