Utrophin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Utrophin Antibody [NBP1-84074] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: Utrophin Antibody [NBP1-84074] - Staining of human liver shows no membranous positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Utrophin Antibody [NBP1-84074] - Staining of human prostate shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Utrophin Antibody [NBP1-84074] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli and cells in tubules.
Immunohistochemistry-Paraffin: Utrophin Antibody [NBP1-84074] - Staining of human stomach shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Utrophin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GELDKQLTTYLTDRIDAFQVPQEAQKIQAEISAHELTLEELRRNMRSQPLTSPESRTARGGSQMDVLQRKLREVSTKFQLFQKPANFEQRMLDCKRVLDGVKAELHVLDVKDVDPDVIQTHLDKCMKLYKTLSEVKLEVETVI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UTRN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Utrophin Protein (NBP1-84074PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Utrophin Antibody

  • DMDLutrophin (homologous to dystrophin)
  • DRP
  • DRP1DRP-1
  • Dystrophin-related protein 1
  • FLJ23678
  • utrophin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-51841
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB110-55290
Species: Hu, Mu, Rt, Po, Ch
Applications: WB, Simple Western, IHC, IHC-P
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC-P, IP
NBP1-86525
Species: Hu
Applications: IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85448
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-85537
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Utrophin Antibody (NBP1-84074) (0)

There are no publications for Utrophin Antibody (NBP1-84074).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Utrophin Antibody (NBP1-84074) (0)

There are no reviews for Utrophin Antibody (NBP1-84074). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Utrophin Antibody (NBP1-84074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Utrophin Products

Bioinformatics Tool for Utrophin Antibody (NBP1-84074)

Discover related pathways, diseases and genes to Utrophin Antibody (NBP1-84074). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Utrophin Antibody (NBP1-84074)

Discover more about diseases related to Utrophin Antibody (NBP1-84074).
 

Pathways for Utrophin Antibody (NBP1-84074)

View related products by pathway.

PTMs for Utrophin Antibody (NBP1-84074)

Learn more about PTMs related to Utrophin Antibody (NBP1-84074).

Blogs on Utrophin

There are no specific blogs for Utrophin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Utrophin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UTRN