![Western Blot: UTP3 Antibody [H00057050-B01P] - Analysis of UTP3 expression in A-431.](http://images.novusbio.com/fullsize/UTP3-Antibody-Western-Blot-H00057050-B01P-img0002.jpg "Western Blot: UTP3 Antibody [H00057050-B01P] - Analysis of UTP3 expression in A-431.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse UTP3 Antibody - Azide and BSA Free (H00057050-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-UTP3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | UTP3 (NP_065101.1, 1 a.a. - 479 a.a.) full-length human protein. MVGRSRRRGAAKWAAVRAKAGPTLTDENGDDLGLPPSPGDTSYYQDQVDDFHEARSRAALAKGWNEVQSGDEEDGEEEEEEVLALDMDDEDDEDGGNAGEEEEEENADDDGGSSVQSEAEASVDPSLSWGQRKKLYYDTDYGSKSRGRQSQQEAEEEEREEEEEAQIIQRRLAQALQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQYLRTKYNLYLNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPKPKSVSKTSAAACAVTDLSDDSDFDEKAKLKYYKEIEDRQKLKRKKEENSTEEQALEDQNAKRAITYQIAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRKEEQRYSGELSGIRAGVKKSIKLK |
| Specificity | This product is specific for Human UTP3 purified MaxPab mouse polyclonal antibody (B01P) [Gene ID: 57050]. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | UTP3 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Mouse polyclonal antibody raised against a full-length human UTP3 protein. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
| Publication using H00057050-B01P | Applications | Species |
|---|---|---|
| Yabing N, Qingyu L, Xiaowei W et al. HCP5 prevents ubiquitination-mediated UTP3 degradation to inhibit apoptosis by activating c-Myc transcriptional activity. Mol Ther. 2022-10-17 [PMID: 36245126] |
Secondary Antibodies |
Isotype Controls |
Research Areas for UTP3 Antibody (H00057050-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UTP3 |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: UTP3 Antibody [H00057050-B01P] - Analysis of purified antibody to SAS10 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/UTP3-Antibody-Immunocytochemistry-Immunofluorescence-H00057050-B01P-img0001.jpg "Immunocytochemistry/Immunofluorescence: UTP3 Antibody [H00057050-B01P] - Analysis of purified antibody to SAS10 on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot: UTP3 Antibody [H00057050-B01P] - Analysis of UTP3 expression in transfected 293T cell line by UTP3 polyclonal antibody. Lane1:SAS10 transfected lysate(52.69 KDa). Lane2:Non-transfected lysate.](http://images.novusbio.com/fullsize/UTP3-Antibody-Western-Blot-H00057050-B01P-img0003.jpg "Western Blot: UTP3 Antibody [H00057050-B01P] - Analysis of UTP3 expression in transfected 293T cell line by UTP3 polyclonal antibody. Lane1:SAS10 transfected lysate(52.69 KDa). Lane2:Non-transfected lysate.")
![Flow Cytometry IL-31RA Antibody [Unconjugated]](https://images.novusbio.com/images2/IL-31_RA_AF2769_Flow_Cytometry_8185.jpg)
![Immunocytochemistry IL-31RA Antibody [Unconjugated]](https://images.novusbio.com/images2/IL31_RA_AF2769_Immunocytochemistry__Immunofluorescence_19095.jpg)
![Immunocytochemistry IL-31RA Antibody [Unconjugated]](https://images.novusbio.com/images2/IL31_RA_AF2769_Immunocytochemistry__Immunofluorescence_19169.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot EBF-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EBF-1_AF5165_Western_Blot_5645.jpg)
![Western Blot EBF-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af5165_human-mouse-ebf-1-affinity-purified-polyclonal-ab-41202412403559.jpg)
![Western Blot EBF-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af5165_human-mouse-ebf-1-affinity-purified-polyclonal-ab-41202412403592.jpg)
![Immunohistochemistry Desmoglein-1 Antibody [Unconjugated] - Propeptide](https://images.novusbio.com/images2/Desmoglein-1_AF944_Immunohistochemistry_9801.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")