USP30 Antibody - BSA Free

Western Blot: USP30 Antibody [NBP1-81914] - Analysis in control (vector only transfected HEK293T lysate) and USP30 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409983).

Immunohistochemistry-Paraffin: USP30 Antibody [NBP1-81914] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: USP30 Antibody [NBP1-81914] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: USP30 Antibody [NBP1-81914] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.

Immunohistochemistry-Paraffin: USP30 Antibody [NBP1-81914] - Staining of human kidney shows moderate to strong cytoplasmic positivity in renal tubules cells.

• Reactivity: Hu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

USP30 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit USP30 Antibody - BSA Free (NBP1-81914) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-USP30 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP30
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  USP30 Protein (NBP1-81914PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (81%). Reactivity reported in scientific literature (PMID: 24896179)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for USP30 Antibody - BSA Free

• Deubiquitinating Enzyme 30
• EC 3.1.2.15
• EC 3.4.19.12
• FLJ40511
• MGC10702
• ubiquitin carboxyl-terminal hydrolase 30
• ubiquitin specific peptidase 30
• ubiquitin specific protease 30
• Ubiquitin Thioesterase 30
• Ubiquitin thiolesterase 30
• ubiquitin-specific protease 30
• Ubiquitin-specific-processing protease 30
• Ub-specific protease 30
• USP30

Background

USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 (PubMed 18287522)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for USP30 Antibody (NBP1-81914)(1)

Publication using NBP1-81914

• Bingol B, Tea JS, Phu L et al. The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy. Nature 2014-06-19 [PMID: 24896179]

Bioinformatics

• Gene Symbol: USP30