MARCH5 Antibody - BSA Free

Western Blot: MARCH5 Antibody [NBP1-59585] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MARCH5 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MARCH5(membrane-associated ring finger (C3HC4) 5) The peptide sequence was selected form the N terminal of 40242. Peptide sequence CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MARCH5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Knockout Validated
  • Western Blot 1.0 ug/ml
• Application Notes: Knockout data reported in scientific literature (PMID: 31881323).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MARCH5 Antibody - BSA Free

• E3 ubiquitin-protein ligase MARCH5
• EC 6.3.2
• EC 6.3.2.-
• FLJ20445
• MARCH-VRNF153
• membrane-associated ring finger (C3HC4) 5
• Membrane-associated RING finger protein 5
• Membrane-associated RING-CH protein V
• Mitochondrial ubiquitin ligase
• RING finger protein 153MITOL

Background

MARCH5 is an ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2) and DRP1 (DNM1L). MARCH5 is a ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2; MIM 608507) and DRP1 (DNM1L; MIM 603850) (Nakamura et al., 2006 [PubMed 16936636]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1502 AK000452.1 3-1504 1503-1863 BC015480.1 1463-1823 1864-1901 BE393612.1 438-475 1902-3713 BC015480.1 1852-3663 3714-3941 BC015480.1 3669-3896

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MARCH5 Antibody (NBP1-59585)(1)

Publication using NBP1-59585

• Park YJ, Oanh NTK, Heo J Dual targeting of RIG-I and MAVS by MARCH5 mitochondria ubiquitin ligase in innate immunity Cell. Signal. 2019-12-24 [PMID: 31881323] (KO, IB, Human)

Bioinformatics

• Gene Symbol: MARCH5
• OMIM:
  • NP_060294(Human)
• Uniprot:
  • Q9NX47(Human)