USP25 Antibody - BSA Free

Western Blot: USP25 Antibody [NBP2-86047] - Host: Rabbit. Target Name: USP25. Sample Tissue: Human THP-1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

USP25 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit USP25 Antibody - BSA Free (NBP2-86047) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human USP25. Peptide sequence: AISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP25
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for USP25 Antibody - BSA Free

• Deubiquitinating enzyme 25
• EC 3.1.2.15
• EC 3.4.19.12
• ubiquitin carboxyl-terminal hydrolase 25
• ubiquitin specific peptidase 25
• ubiquitin specific protease USP2510USP21ubiquitin specific protease 25
• ubiquitin thioesterase 25
• Ubiquitin Thiolesterase 25
• ubiquitin-specific processing protease 25
• Ubiquitin-specific-processing protease 25
• USP on chromosome 21
• USP25

Background

USP25 is a ubiquitin-specific protease. Ubiquitin (MIM 191339) is a highly conserved 76-amino acid protein involved in regulation of intracellular protein breakdown, cell cycle regulation, and stress response. Ubiquitin is released from degraded proteins by disassembly of the polyubiquitin chains, which is mediated by ubiquitin-specific proteases (USPs), such as USP25 (Valero et al., 1999 [PubMed 10644437]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP25