USP2 Antibody

Images

 
Western Blot: USP2 Antibody [NBP1-86882] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: USP2 Antibody [NBP1-86882] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: USP2 Antibody [NBP1-86882] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Western Blot: USP2 Antibody [NBP1-86882] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SGFPYGVTNNCLSYLPINAYDQGVTLTQKLDSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIISPTYR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
USP2 Protein (NBP1-86882PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP2 Antibody

  • Deubiquitinating enzyme 2
  • EC 3.1.2.15
  • EC 3.4.19.12,41 kDa ubiquitin-specific protease
  • ubiquitin specific peptidase 2
  • ubiquitin specific protease 12
  • ubiquitin specific protease 2
  • ubiquitin specific protease 9
  • ubiquitin thioesterase 2
  • Ubiquitin thiolesterase 2
  • Ubiquitin-specific-processing protease 2
  • UBP41
  • UBP41ubiquitin carboxyl-terminal hydrolase 2
  • USP2
  • USP9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54974
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-88117
Species: Hu
Applications: WB (-), WB, IHC, IHC-P, IP
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-48321
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-15141
Species: Hu
Applications: WB
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86882
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for USP2 Antibody (NBP1-86882) (0)

There are no publications for USP2 Antibody (NBP1-86882).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP2 Antibody (NBP1-86882) (0)

There are no reviews for USP2 Antibody (NBP1-86882). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP2 Antibody (NBP1-86882) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP2 Products

Bioinformatics Tool for USP2 Antibody (NBP1-86882)

Discover related pathways, diseases and genes to USP2 Antibody (NBP1-86882). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP2 Antibody (NBP1-86882)

Discover more about diseases related to USP2 Antibody (NBP1-86882).
 

Pathways for USP2 Antibody (NBP1-86882)

View related products by pathway.

PTMs for USP2 Antibody (NBP1-86882)

Learn more about PTMs related to USP2 Antibody (NBP1-86882).

Blogs on USP2

There are no specific blogs for USP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP2
Entrez