USP16 Antibody - BSA Free

Western Blot: USP16 Antibody [NBP3-38203] - Western blot analysis of various lysates, using USP16 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt, Pm
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

USP16 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human USP16 (NP_001001992.1).
  
  Sequence:
  MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRKQASITTPKPEKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDLALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGVVTPKEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 94 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for USP16 Antibody - BSA Free

• Deubiquitinating enzyme 16
• EC 3.1.2.15
• EC 3.4.19.12
• human ubiquitin processing protease, EC 3.1.2.1510ubiquitin specific protease 16
• ubiquitin carboxyl-terminal hydrolase 16
• ubiquitin specific peptidase 16
• ubiquitin thioesterase 16
• Ubiquitin thiolesterase 16
• Ubiquitin-processing protease UBP-M
• ubiquitin-specific processing protease 16
• Ubiquitin-specific-processing protease 16
• UBP-M
• USP16

Background

Ubiquitin (Ub) is a highly conserved protein found ubiquitously in eukaryotic organisms. The conjugation of ubiquitin to proteins is an important means to regulate protein activity for many cellular processes by tagging them for degradation. Removal of Ub can rescue proteins from degradation. This is accomplished by the ubiquitin-specific processing protease (UBP) family of enzymes. Ubiquitin specific processing protease 16 (USP16) is a member of this family. USP16 activity is cell cycle regulated via phosphorylation and participates in cell cycle control by influencing mitotic chromosome condensation and histone 2A (H2A) deubiquitination.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP16