![Immunocytochemistry/Immunofluorescence: USP13 Antibody [NBP1-83088] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.](http://images.novusbio.com/fullsize/USP13-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83088-img0004.jpg "Immunocytochemistry/Immunofluorescence: USP13 Antibody [NBP1-83088] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit USP13 Antibody - BSA Free (NBP1-83088) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-USP13 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFVIEMENNANANIISEAKPEGPRVKDGSGTYELFAFISH |
| Predicted Species | Mouse (92%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | USP13 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC reported in scientific literature (PMID: 26625006). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
|
Beclin 1: Regulator of Autophagy and Apoptosis Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | USP13 |
![Immunohistochemistry: USP13 Antibody [NBP1-83088] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/USP13-Antibody-Immunohistochemistry-NBP1-83088-img0006.jpg "Immunohistochemistry: USP13 Antibody [NBP1-83088] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: USP13 Antibody [NBP1-83088] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.](http://images.novusbio.com/fullsize/USP13-Antibody-Immunohistochemistry-Paraffin-NBP1-83088-img0002.jpg "Immunohistochemistry-Paraffin: USP13 Antibody [NBP1-83088] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.")
![Immunohistochemistry-Paraffin: USP13 Antibody [NBP1-83088] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/USP13-Antibody-Immunohistochemistry-Paraffin-NBP1-83088-img0005.jpg "Immunohistochemistry-Paraffin: USP13 Antibody [NBP1-83088] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.")
![ISG15/UCRP [7-Amino-4-Methyl Coumarin]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ISG15/UCRP [7-Amino-4-Methyl Coumarin]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")