USP13 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: USP13 Antibody [NBP1-83088] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: USP13 Antibody [NBP1-83088] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFVIEMENNANANIISEAKPEGPRVKDGSGTYELFAFISH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
USP13 Protein (NBP1-83088PEP)
Publications
Read Publications using
NBP1-83088 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22093360)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP13 Antibody

  • Deubiquitinating enzyme 13
  • EC 3.1.2.15
  • EC 3.4.19.12
  • Isopeptidase T-3
  • IsoT-3
  • ISOT3IsoT-3
  • ubiquitin carboxyl-terminal hydrolase 13
  • ubiquitin specific peptidase 13 (isopeptidase T-3)
  • ubiquitin specific protease 13 (isopeptidase T-3)
  • Ubiquitin Thioesterase 13
  • Ubiquitin thiolesterase 13
  • Ubiquitin-specific-processing protease 13
  • USP13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02648
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-92566
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-88117
Species: Hu
Applications: WB (-), WB, IHC, IHC-P, IP
NBP2-47279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00009960-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-46289
Species: Hu
Applications: WB, IHC
H00009097-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
E-504
Species: Hu
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF4885
Species: Mu
Applications: WB, IP
NBP1-91949
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69801
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IF
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-13509
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for USP13 Antibody (NBP1-83088)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for USP13 Antibody (NBP1-83088) (0)

There are no reviews for USP13 Antibody (NBP1-83088). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for USP13 Antibody (NBP1-83088) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP13 Products

Bioinformatics Tool for USP13 Antibody (NBP1-83088)

Discover related pathways, diseases and genes to USP13 Antibody (NBP1-83088). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP13 Antibody (NBP1-83088)

Discover more about diseases related to USP13 Antibody (NBP1-83088).
 

Pathways for USP13 Antibody (NBP1-83088)

View related products by pathway.

PTMs for USP13 Antibody (NBP1-83088)

Learn more about PTMs related to USP13 Antibody (NBP1-83088).

Blogs on USP13.

Beclin 1: Regulator of Autophagy and Apoptosis
Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP13
Entrez