Uroplakin III Antibody - BSA Free

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Staining of human stomach shows no positivity in glandular cells as expected.

Staining of human liver, pancreas, stomach and urinary bladder using Anti-UPK3A antibody NBP1-86874 (A) shows similar protein distribution across tissues to independent antibody NBP1-86873 (B).

Analysis in human urinary bladder and pancreas tissues Corresponding UPK3A RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Uroplakin III Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Uroplakin III Antibody - BSA Free (NBP1-86874) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QILNAYLVRVGANGTCLWDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGGMIVIT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UPK3A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Uroplakin III Protein (NBP1-86874PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Uroplakin III Antibody - BSA Free

• MGC119178
• UP3a
• UPIII
• UPIIIA
• UPK3
• UPK3A
• uroplakin 3
• uroplakin 3A
• Uroplakin III
• uroplakin3a
• uroplakin-3a

Background

Uroplakins are specific differentiation products of terminally differentiated superficial urothelial cells. Uroplakin III is a highly specific and moderately sensitive immunohistochemical marker for primary and metastatic urothelial carcinomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UPK3A