| Reactivity | HuSpecies Glossary |
| Applications | WB, Flow, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Uroplakin II Antibody - BSA Free (NBP2-38904) is a polyclonal antibody validated for use in IHC, WB, Flow and ICC/IF. Anti-Uroplakin II Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SVVDSGAGFTVTRLSAYQVTNLVPGTKFYISYLVKKGTATESSREIPMSTLPRRNMESIGLG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UPK2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-38904 | Applications | Species |
|---|---|---|
| Jafari NV, Rohn JL An immunoresponsive three-dimensional urine-tolerant human urothelial model to study urinary tract infection Frontiers in cellular and infection microbiology 2023-03-27 [PMID: 37051302] (Immunocytochemistry/ Immunofluorescence, Human) | Immunocytochemistry/ Immunofluorescence | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
Flow | Human | 01/19/2016 |
Summary
|
||||||||
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 01/19/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 01/19/2016 |
||
| Application: | Flow | |
| Species: | Human |
| Verified Customer 01/19/2016 |
||
| Application: | WB | |
| Species: | Human |