Uroplakin III Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Uroplakin III Antibody [NBP1-86873] - Staining of human cell line U-2 OS shows positivity in nuclear membrane.
Immunohistochemistry-Paraffin: Uroplakin III Antibody [NBP1-86873] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Uroplakin III Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TFATNNPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSAISRNASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDLPSLDAIGDVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UPK3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
Bladder Lysate (NB820-59467)
Control Peptide
Uroplakin III Protein (NBP1-86873PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Uroplakin III Antibody

  • MGC119178
  • UP3a
  • UPIII
  • UPIIIA
  • UPK3
  • UPK3A
  • uroplakin 3
  • uroplakin 3A
  • Uroplakin III
  • uroplakin3a
  • uroplakin-3a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38904
Species: Hu
Applications: Flow, IHC, IHC-P
H00007348-M05
Species: Hu
Applications: WB, ELISA
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14694
Species: Hu
Applications: IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-14694
Species: Hu
Applications: IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Uroplakin III Antibody (NBP1-86873) (0)

There are no publications for Uroplakin III Antibody (NBP1-86873).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Uroplakin III Antibody (NBP1-86873) (0)

There are no reviews for Uroplakin III Antibody (NBP1-86873). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Uroplakin III Antibody (NBP1-86873) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Uroplakin III Products

Bioinformatics Tool for Uroplakin III Antibody (NBP1-86873)

Discover related pathways, diseases and genes to Uroplakin III Antibody (NBP1-86873). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Uroplakin III Antibody (NBP1-86873)

Discover more about diseases related to Uroplakin III Antibody (NBP1-86873).
 

Pathways for Uroplakin III Antibody (NBP1-86873)

View related products by pathway.

PTMs for Uroplakin III Antibody (NBP1-86873)

Learn more about PTMs related to Uroplakin III Antibody (NBP1-86873).

Blogs on Uroplakin III

There are no specific blogs for Uroplakin III, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Uroplakin III Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UPK3A