Uromodulin Antibody

Images

 
Western Blot: Uromodulin Antibody [NBP2-33393] - Analysis in human kidney tissue.
Immunohistochemistry-Paraffin: Uromodulin Antibody [NBP2-33393] - Staining in human kidney and cerebral cortex tissues using NBP2-33393 antibody. Corresponding UMOD RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Uromodulin Antibody [NBP2-33393] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Uromodulin Antibody [NBP2-33393] - Staining of human cerebral cortex, kidney, placenta and testis using Anti-UMOD antibody NBP2-33393 (A) shows similar protein distribution across tissues ...read more
Immunohistochemistry-Paraffin: Uromodulin Antibody [NBP2-33393] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Uromodulin Antibody [NBP2-33393] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry-Paraffin: Uromodulin Antibody [NBP2-33393] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Uromodulin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGK
Specificity
Specificity of human Uromodulin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UMOD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Uromodulin Protein (NBP2-33393PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Uromodulin Antibody

  • ADMCKD2
  • FJHN
  • HNFJ
  • HNFJ1
  • MCKD2
  • Tamm-Horsfall glycoprotein
  • Tamm-Horsfall urinary glycoprotein
  • THGP
  • THP
  • UMOD
  • uromodulin (uromucoid, Tamm-Horsfall glycoprotein)
  • Uromodulin
  • Uromucoid

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-89680
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, ChIP
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NBP2-45731
Species: Hu, Ca, Pm, All-NA
Applications: WB, IHC, IHC-P
NBP2-76910
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Uromodulin Antibody (NBP2-33393) (0)

There are no publications for Uromodulin Antibody (NBP2-33393).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Uromodulin Antibody (NBP2-33393) (0)

There are no reviews for Uromodulin Antibody (NBP2-33393). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Uromodulin Antibody (NBP2-33393) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Uromodulin Products

Bioinformatics Tool for Uromodulin Antibody (NBP2-33393)

Discover related pathways, diseases and genes to Uromodulin Antibody (NBP2-33393). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Uromodulin Antibody (NBP2-33393)

Discover more about diseases related to Uromodulin Antibody (NBP2-33393).
 

Pathways for Uromodulin Antibody (NBP2-33393)

View related products by pathway.

PTMs for Uromodulin Antibody (NBP2-33393)

Learn more about PTMs related to Uromodulin Antibody (NBP2-33393).
 

Research Areas for Uromodulin Antibody (NBP2-33393)

Find related products by research area.

Blogs on Uromodulin

There are no specific blogs for Uromodulin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Uromodulin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UMOD
Uniprot