URI Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: URI Antibody [NBP2-57701] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: URI Antibody [NBP2-57701] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

URI Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGK
Specificity
Specificity of human URI antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
URI1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
URI Recombinant Protein Antigen (NBP2-57701PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for URI Antibody

  • chromosome 19 open reading frame 2
  • FLJ10575
  • NNX3RPB5-mediating protein
  • Protein NNX3
  • RMPunconventional prefoldin RPB5 interactor
  • RNA polymerase II subunit 5-mediating protein
  • URIRNA polymerase II, subunit 5-mediating protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-24689
Species: Hu, Mu
Applications: WB
NBP1-43281
Species: Mu
Applications: Flow, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-00482
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-30032
Species: Hu, Mu, Bv, Ca, Fe, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-26096
Species: Hu, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-88191
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-32622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20119
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-58906
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD

Publications for URI Antibody (NBP2-57701) (0)

There are no publications for URI Antibody (NBP2-57701).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for URI Antibody (NBP2-57701) (0)

There are no reviews for URI Antibody (NBP2-57701). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for URI Antibody (NBP2-57701) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional URI Products

Array NBP2-57701

Bioinformatics Tool for URI Antibody (NBP2-57701)

Discover related pathways, diseases and genes to URI Antibody (NBP2-57701). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for URI Antibody (NBP2-57701)

Discover more about diseases related to URI Antibody (NBP2-57701).
 

Pathways for URI Antibody (NBP2-57701)

View related products by pathway.

PTMs for URI Antibody (NBP2-57701)

Learn more about PTMs related to URI Antibody (NBP2-57701).

Blogs on URI

There are no specific blogs for URI, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our URI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol URI1