URB/CCD80 Antibody

Images

 
Immunohistochemistry: URB/CCD80 Antibody [NBP1-87965] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

URB/CCD80 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MMSLLKDDVYCELAERHIQQIVLFHQAGEEGGKVRRITSEGQILEQPLDPSLIPKLMSFLKLEKGKFGMVLLKKTLQVEERYPYPVRLEAMYEVIDQGPIRRIEKIRQKGFVQKCKASGVEGQVVAEGNDGGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC80
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
URB/CCD80 Protein (NBP1-87965PEP)
Publications
Read Publication using NBP1-87965.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for URB/CCD80 Antibody

  • CCDC80
  • coiled-coil domain containing 80
  • down-regulated by oncogenes protein 1
  • DRO1
  • SSG1
  • Steroid-sensitive protein 1
  • URB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP1-77086
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88460
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86999
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24748
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NB100-1704
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-87965
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for URB/CCD80 Antibody (NBP1-87965)(1)

Reviews for URB/CCD80 Antibody (NBP1-87965) (0)

There are no reviews for URB/CCD80 Antibody (NBP1-87965). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for URB/CCD80 Antibody (NBP1-87965) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional URB/CCD80 Products

Bioinformatics Tool for URB/CCD80 Antibody (NBP1-87965)

Discover related pathways, diseases and genes to URB/CCD80 Antibody (NBP1-87965). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for URB/CCD80 Antibody (NBP1-87965)

Discover more about diseases related to URB/CCD80 Antibody (NBP1-87965).
 

Pathways for URB/CCD80 Antibody (NBP1-87965)

View related products by pathway.

Blogs on URB/CCD80

There are no specific blogs for URB/CCD80, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our URB/CCD80 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC80
Entrez