Novus Biologicals products are now on bio-techne.com

URB/CCD80 Antibody

Images

 
Immunohistochemistry-Paraffin: URB/CCD80 Antibody [NBP1-87965] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

URB/CCD80 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MMSLLKDDVYCELAERHIQQIVLFHQAGEEGGKVRRITSEGQILEQPLDPSLIPKLMSFLKLEKGKFGMVLLKKTLQVEERYPYPVRLEAMYEVIDQGPIRRIEKIRQKGFVQKCKASGVEGQVVAEGNDGGG
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC80
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
URB/CCD80 Protein (NBP1-87965PEP)
Publications
Read Publication using NBP1-87965.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for URB/CCD80 Antibody

  • CCDC80
  • coiled-coil domain containing 80
  • down-regulated by oncogenes protein 1
  • DRO1
  • SSG1
  • Steroid-sensitive protein 1
  • URB

Background

CCD80 is expressed in dermal papilla and dermal fibroblasts (at protein level) and in heart, thymus, placenta, pancreas, colon, epithelium, spleen and osteoblasts. There are three named isoforms produced by alternative splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-314
Species: Hu
Applications: IP, WB
NBP1-77086
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
AF7094
Species: Hu
Applications: IHC
NB100-2288
Species: Am, Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
DCP00
Species: Hu
Applications: ELISA
DRP300
Species: Hu
Applications: ELISA
NBP1-88461
Species: Hu
Applications: IHC, IHC-P
NBP1-77370
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-24748
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-24859
Species: Ca, Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NBP2-83997
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87965
Species: Hu, Mu, Rt
Applications: IHC

Publications for URB/CCD80 Antibody (NBP1-87965)(1)

Reviews for URB/CCD80 Antibody (NBP1-87965) (0)

There are no reviews for URB/CCD80 Antibody (NBP1-87965). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for URB/CCD80 Antibody (NBP1-87965) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our URB/CCD80 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC80