REPS1 Antibody

Images

 
Western Blot: REPS1 Antibody [NBP1-86344] - Analysis in control (vector only transfected HEK293T lysate) and REPS1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: REPS1 Antibody [NBP1-86344] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

REPS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QEMELKRTGSDHTNPTSPLLVKPSDLLEENKINSSVKFASGNTVADGYSSSDSFTSDPEQIGSNVTRQRSHSGTSPDNTAPP
Specificity
Specificity of human REPS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
REPS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
REPS1 Protein (NBP1-86344PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for REPS1 Antibody

  • RALBP1 associated Eps domain containing 1
  • RALBP1
  • ralBP1-associated Eps domain-containing protein 1
  • RalBP1-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF, KD
NBP1-87826
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56173
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP1-83786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, GS, KD, KO
NBP1-80891
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56144
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, BA, B/N, Flow-IC
NB100-56116
Species: Hu, Mu, Rt, Ma
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-93790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP

Publications for REPS1 Antibody (NBP1-86344) (0)

There are no publications for REPS1 Antibody (NBP1-86344).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REPS1 Antibody (NBP1-86344) (0)

There are no reviews for REPS1 Antibody (NBP1-86344). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for REPS1 Antibody (NBP1-86344) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional REPS1 Products

Bioinformatics Tool for REPS1 Antibody (NBP1-86344)

Discover related pathways, diseases and genes to REPS1 Antibody (NBP1-86344). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REPS1 Antibody (NBP1-86344)

Discover more about diseases related to REPS1 Antibody (NBP1-86344).
 

Pathways for REPS1 Antibody (NBP1-86344)

View related products by pathway.

PTMs for REPS1 Antibody (NBP1-86344)

Learn more about PTMs related to REPS1 Antibody (NBP1-86344).

Blogs on REPS1

There are no specific blogs for REPS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our REPS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol REPS1