![Immunohistochemistry-Paraffin: UNC93B Antibody [NBP1-80635] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/UNC93B-Antibody-Immunohistochemistry-Paraffin-NBP1-80635-img0004.jpg "Immunohistochemistry-Paraffin: UNC93B Antibody [NBP1-80635] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit UNC93B Antibody - BSA Free (NBP1-80635) is a polyclonal antibody validated for use in IHC. Anti-UNC93B Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NHYLYDLNHTLYNVQSCGTNSHGILSGFNKTVLRTLPRSGN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UNC93B1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Western_Blot_5226.jpg)
![Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/16351.jpg)
![Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Flow_Cytometry_8189.jpg)
| Publication using NBP1-80635 | Applications | Species |
|---|---|---|
| Hazra R, Brine L, Garcia L et al. Platr4 is an early embryonic lncRNA that exerts its function downstream on cardiogenic mesodermal lineage commitment Developmental cell 2022-11-07 [PMID: 36347239] (RIP, Mouse) | RIP | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for UNC93B Antibody (NBP1-80635)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry PRAT4A/TNRC5 Antibody [Unconjugated]](https://images.novusbio.com/images2/PRAT4A_AF4429_Immunohistochemistry_22146.jpg)
![Western Blot PRAT4A/TNRC5 Antibody [Unconjugated]](https://images.novusbio.com/images2/PRAT4A_AF4429_Western_Blot_9541.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![Western Blot Tyk2 Antibody (307214) [Unconjugated]](https://images.novusbio.com/images2/Tyk2_MAB3427_Western_Blot_6105.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")