UNC5H3/UNC5C Antibody


Western Blot: UNC5H3/UNC5C Antibody [NBP1-69283] - This Anti-UNC5C antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

UNC5H3/UNC5C Antibody Summary

The immunogen for anti-UNC5C antibody: synthetic peptide directed towards the C terminal of human UNC5C (NP_003719). Peptide sequence WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
103 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UNC5H3/UNC5C Antibody

  • netrin receptor UNC5C
  • Protein unc-5 homolog 3
  • Protein unc-5 homolog C
  • unc-5 homolog 3
  • unc-5 homolog C (C. elegans)
  • UNC5C
  • UNC5H3
  • UNC5H3unc5 (C.elegans homolog) c


UNC5C belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, Block
Species: Rt
Applications: WB, IHC
Species: Rt
Applications: WB, Block, ICC
Species: Hu, Mu
Applications: WB, Simple Western, IHC, Block
Species: Hu, Mu, Rt
Applications: WB, Neut
Species: Hu
Applications: WB
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for UNC5H3/UNC5C Antibody (NBP1-69283) (0)

There are no publications for UNC5H3/UNC5C Antibody (NBP1-69283).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UNC5H3/UNC5C Antibody (NBP1-69283) (0)

There are no reviews for UNC5H3/UNC5C Antibody (NBP1-69283). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UNC5H3/UNC5C Antibody (NBP1-69283) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UNC5H3/UNC5C Products

Bioinformatics Tool for UNC5H3/UNC5C Antibody (NBP1-69283)

Discover related pathways, diseases and genes to UNC5H3/UNC5C Antibody (NBP1-69283). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UNC5H3/UNC5C Antibody (NBP1-69283)

Discover more about diseases related to UNC5H3/UNC5C Antibody (NBP1-69283).

Pathways for UNC5H3/UNC5C Antibody (NBP1-69283)

View related products by pathway.

PTMs for UNC5H3/UNC5C Antibody (NBP1-69283)

Learn more about PTMs related to UNC5H3/UNC5C Antibody (NBP1-69283).

Research Areas for UNC5H3/UNC5C Antibody (NBP1-69283)

Find related products by research area.

Blogs on UNC5H3/UNC5C

There are no specific blogs for UNC5H3/UNC5C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UNC5H3/UNC5C Antibody and receive a gift card or discount.


Gene Symbol UNC5C