UNC5H3/UNC5C Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to UNC5C(unc-5 homolog C (C. elegans)) The peptide sequence was selected form the middle region of UNC5C. Peptide sequence VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTS. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
UNC5C |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for UNC5H3/UNC5C Antibody - BSA Free
Background
UNC5C belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: Bind
Species: Mu
Applications: Block, IHC, WB
Species: Rt
Applications: IHC, WB
Species: Rt
Applications: Block, ICC, WB
Species: Hu, Mu
Applications: Block, IHC, Simple Western, WB
Species: Mu
Applications: IHC
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB
Publications for UNC5H3/UNC5C Antibody (NBP1-62248) (0)
There are no publications for UNC5H3/UNC5C Antibody (NBP1-62248).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for UNC5H3/UNC5C Antibody (NBP1-62248) (0)
There are no reviews for UNC5H3/UNC5C Antibody (NBP1-62248).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for UNC5H3/UNC5C Antibody (NBP1-62248) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional UNC5H3/UNC5C Products
Research Areas for UNC5H3/UNC5C Antibody (NBP1-62248)
Find related products by research area.
|
Blogs on UNC5H3/UNC5C