UGT8 Antibody

Images

 
Immunohistochemistry-Paraffin: UGT8 Antibody [NBP1-84494] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UGT8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UGT8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UGT8 Protein (NBP1-84494PEP)
Publications
Read Publication using NBP1-84494.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UGT8 Antibody

  • Ceramide UDP-galactosyltransferase
  • Cerebroside synthase
  • CGT2-hydroxyacylsphingosine 1-beta-galactosyltransferase
  • EC 2.4.1
  • EC 2.4.1.45
  • UDP glycosyltransferase 8
  • UDP-galactose ceramide galactosyltransferase
  • UDP-galactose-ceramide galactosyltransferase
  • UGT4
  • uridine diphosphate glycosyltransferase 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15533
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF2485
Species: Hu
Applications: WB, IHC, IP
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007357-M03
Species: Hu
Applications: WB, ELISA
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP2-16578
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-84494
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for UGT8 Antibody (NBP1-84494)(1)

Reviews for UGT8 Antibody (NBP1-84494) (0)

There are no reviews for UGT8 Antibody (NBP1-84494). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for UGT8 Antibody (NBP1-84494) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGT8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGT8