![Immunohistochemistry-Paraffin: UGT8 Antibody [NBP1-84494] - Staining of human duodenum shows strong positivity in apical membrane of glandular cells, as well as moderate cytoplasmic immunoreactivity.](http://images.novusbio.com/fullsize/UGT8-Antibody-Immunohistochemistry-Paraffin-NBP1-84494-img0004.jpg "Immunohistochemistry-Paraffin: UGT8 Antibody [NBP1-84494] - Staining of human duodenum shows strong positivity in apical membrane of glandular cells, as well as moderate cytoplasmic immunoreactivity.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit UGT8 Antibody - BSA Free (NBP1-84494) is a polyclonal antibody validated for use in IHC. Anti-UGT8 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPA |
| Predicted Species | Mouse (96%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UGT8 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-84494 | Applications | Species |
|---|---|---|
| Dzi?giel P, Owczarek T, Plazuk E et al. Ceramide galactosyltransferase (UGT8) is a molecular marker of breast cancer malignancy and lung metastases. Br J Cancer 2010-08-01 [PMID: 20648017] |
Secondary Antibodies |
Isotype Controls |
Research Areas for UGT8 Antibody (NBP1-84494)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UGT8 |
![Immunohistochemistry-Paraffin: UGT8 Antibody [NBP1-84494] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/UGT8-Antibody-Immunohistochemistry-Paraffin-NBP1-84494-img0002.jpg "Immunohistochemistry-Paraffin: UGT8 Antibody [NBP1-84494] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: UGT8 Antibody [NBP1-84494] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.](http://images.novusbio.com/fullsize/UGT8-Antibody-Immunohistochemistry-Paraffin-NBP1-84494-img0003.jpg "Immunohistochemistry-Paraffin: UGT8 Antibody [NBP1-84494] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.")
![Immunohistochemistry-Paraffin: UGT8 Antibody [NBP1-84494] - Staining of human cerebellum shows strong cytoplasmic positivity in glial cells.](http://images.novusbio.com/fullsize/UGT8-Antibody-Immunohistochemistry-Paraffin-NBP1-84494-img0005.jpg "Immunohistochemistry-Paraffin: UGT8 Antibody [NBP1-84494] - Staining of human cerebellum shows strong cytoplasmic positivity in glial cells.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Enzyme Activity Galactosylceramidase/GALC [Unconjugated]](https://images.novusbio.com/images2/7310-gh_recombinant-human-galactosylceramidase-galc-protein-cf-enzyme-activity-222023135127.jpg)
![Enzyme Activity Galactosylceramidase/GALC [Unconjugated]](https://images.novusbio.com/images2/7310-gh_recombinant-human-galactosylceramidase-galc-protein-cf-enzyme-activity-222023141635.jpg)
![SDS-PAGE Galactosylceramidase/GALC [Unconjugated]](https://images.novusbio.com/images2/7310-gh_recombinant-human-galactosylceramidase-galc-protein-cf-sds-page-222023142253.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")