UGGT1 Antibody

Images

 
Independent Antibodies: Western Blot: UGGT1 Antibody [NBP1-81652] - Analysis using Anti-UGGT1 antibody NBP1-81652 (A) shows similar pattern to independent antibody NBP1-81651 (B).
Immunohistochemistry-Paraffin: UGGT1 Antibody [NBP1-81652] - Staining of human Lymph node shows strong granular cytoplasmic positivity in non-germinal center cells.
Western Blot: UGGT1 Antibody [NBP1-81652] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: UGGT1 Antibody [NBP1-81652] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: UGGT1 Antibody [NBP1-81652] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-UGGT1 antibody NBP1-81652 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: UGGT1 Antibody [NBP1-81652] - Staining of human lymph node.
Immunohistochemistry-Paraffin: UGGT1 Antibody [NBP1-81652] - Staining of human testis.
Immunohistochemistry-Paraffin: UGGT1 Antibody [NBP1-81652] - Staining of human liver.
Immunohistochemistry-Paraffin: UGGT1 Antibody [NBP1-81652] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: UGGT1 Antibody [NBP1-81652] - Staining of human Cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: UGGT1 Antibody [NBP1-81652] - Staining of human cerebral cortex, gastrointestinal, lymphoid tissues and pancreas using Anti-UGGT1 antibody NBP1-81652 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: UGGT1 Antibody [NBP1-81652] - Staining of human Duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: UGGT1 Antibody [NBP1-81652] - Staining of human Pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

UGGT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DFILSHAVYCRDVLKLKKGQRAVISNGRIIGPLEDSELFNQDDFHLLENIILKTSGQKIKSHIQQLRVEEDVASDLVMKVDALLSAQPKGDPRIEYQFFEDRHSAIKLRPKEGETYFDVVAVVDPV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UGGT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 1:100-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UGGT1 Protein (NBP1-81652PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UGGT1 Antibody

  • FLJ21763
  • GT
  • HUGT1
  • UDP--Glc:glycoprotein glucosyltransferase
  • UDP-glucose ceramide glucosyltransferase-like 1
  • UDP-glucose glycoprotein glucosyltransferase 1
  • UGCGL1
  • UGGT
  • UGT1
  • UGTR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
MAB8400
Species: Hu
Applications: CyTOF-ready, Flow, WB
DPSG10
Species: Hu
Applications: ELISA
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP3-03338
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for UGGT1 Antibody (NBP1-81652) (0)

There are no publications for UGGT1 Antibody (NBP1-81652).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGGT1 Antibody (NBP1-81652) (0)

There are no reviews for UGGT1 Antibody (NBP1-81652). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGGT1 Antibody (NBP1-81652) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UGGT1 Products

Array NBP1-81652

Bioinformatics Tool for UGGT1 Antibody (NBP1-81652)

Discover related pathways, diseases and genes to UGGT1 Antibody (NBP1-81652). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGGT1 Antibody (NBP1-81652)

Discover more about diseases related to UGGT1 Antibody (NBP1-81652).
 

Pathways for UGGT1 Antibody (NBP1-81652)

View related products by pathway.

Blogs on UGGT1

There are no specific blogs for UGGT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGGT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGGT1