UGGT1 Antibody


Western Blot: UGGT1 Antibody [NBP1-70764] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

UGGT1 Antibody Summary

Synthetic peptides corresponding to UGCGL1 (UDP-glucose glycoprotein glucosyltransferase 1) The peptide sequence was selected from the middle region of UGCGL1. Peptide sequence AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against UGCGL1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UGGT1 Antibody

  • FLJ21763
  • GT
  • HUGT1
  • UDP--Glc:glycoprotein glucosyltransferase
  • UDP-glucose ceramide glucosyltransferase-like 1
  • UDP-glucose glycoprotein glucosyltransferase 1
  • UGCGL1
  • UGGT
  • UGT1
  • UGTR


UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
Species: Hu
Applications: WB, IHC, ICC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UGGT1 Antibody (NBP1-70764) (0)

There are no publications for UGGT1 Antibody (NBP1-70764).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGGT1 Antibody (NBP1-70764) (0)

There are no reviews for UGGT1 Antibody (NBP1-70764). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGGT1 Antibody (NBP1-70764) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UGGT1 Products

UGGT1 NBP1-70764

Bioinformatics Tool for UGGT1 Antibody (NBP1-70764)

Discover related pathways, diseases and genes to UGGT1 Antibody (NBP1-70764). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGGT1 Antibody (NBP1-70764)

Discover more about diseases related to UGGT1 Antibody (NBP1-70764).

Pathways for UGGT1 Antibody (NBP1-70764)

View related products by pathway.

Blogs on UGGT1

There are no specific blogs for UGGT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UGGT1 Antibody and receive a gift card or discount.


Gene Symbol UGGT1