Home » UGCG » UGCG Antibodies » UGCG Antibody

UGCG Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: UGCG Antibody [H00007357-A01]
Western Blot: UGCG Antibody [H00007357-A01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

UGCG Antibody Summary

Immunogen
UGCG (NP_003349, 33 a.a. - 131 a.a.) partial recombinant protein with GST tag. TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPG
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
UGCG
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for WB and ELISA.
Positive Control
UGCG Lysate (NBP2-65397)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UGCG Antibody

  • ceramide glucosyltransferase
  • EC 2.4.1.80
  • GCSGLCT1
  • GLCT-1
  • Glucosylceramide synthase
  • UDP-glucose ceramide glucosyltransferaseUDP-glucose:N-acylsphingosine D-glucosyltransferase

Background

Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes. UDP-glucose ceramide glucosyltransferase catalyzes the first glycosylation step in glycosphingolipid biosynthesis. The product, glucosylceramide, is the core structure of more than 300 GSLs. UGCG is widely expressed and transciption is upregulated during keratinocyte differentiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GCLC Antibody (3H1)
H00002729-M01
Western Blot: GCLC Antibody (3H1) [H00002729-M01] - GCLC monoclonal antibody (M01), clone 3H1. Analysis of GCLC expression in NIH/3T3.
Immunocytochemistry/Immunofluorescence: GCLC Antibody (3H1) [H00002729-M01] - Analysis of monoclonal antibody to GCLC on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: GCLC Antibody (3H1) [H00002729-M01] - GCLC monoclonal antibody (M01), clone 3H1. Analysis of GCLC expression in PC-12.
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MDR1/ABCB1 Antibody
NB100-80870
Western Blot: MDR1/ABCB1 Antibody [NB100-80870] - Analyis of anti-ABCB1 antibody shows detection of ABCB1 in crude membrane extracts from HF insect cells over-expressing human ABCB1. The extract was loaded onto a gel in the amounts indicated followed by electrophoresis and transfer to nitrocellulose. The membrane was probed with the primary antibody diluted to 1:600, followed by Peroxidase Conjugated Affinity Purified Anti-RABBIT IgG at 1:10000. Personal Communication, Anna Calcagno, CCR-NCI, Bethesda, MD.
Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody [NB100-80870] - Staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
(1 Review)
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(494 Publications)
Species: Hu
Cathepsin
A/Lysosomal Carboxype ...
NBP1-89728
Western Blot: Cathepsin A/Lysosomal Carboxypeptidase A Antibody [NBP1-89728] - Analysis in human cell line U-87 MG.
Immunocytochemistry/Immunofluorescence: Cathepsin A/Lysosomal Carboxypeptidase A Antibody [NBP1-89728] - Staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: Cathepsin A/Lysosomal Carboxypeptidase A Antibody [NBP1-89728] - Staining in human kidney and skeletal muscle tissues. Corresponding CTSA RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
GM-CSF
[Unconjugated]
215-GM/CF
1 μg/lane of Recombinant Human GM-CSF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human GM-CSF (Catalog # 215-IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 6-30 pg/mL.
(204 Publications)
Species: Hu
LAMC2 Antibody
(CL2980)
NBP2-42388
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LAMC2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining in human fallopian tube and liver tissues. Corresponding LAMC2 RNA-seq data are presented for the same tissues.
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221.
Species: Hu
Applications: WB, IHC, IHC-P, KD
Glutathione
Reductase Antibody
NBP2-24940
Western Blot: Glutathione Reductase Antibody [NBP2-24940] - analysis of GR (2- Glutathione reductase from S. cerevisiae) in human liver lysate using this antibody. 5 ug/ml.
(1 Publication)
Species: Hu, Ye
Applications: WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(12 Publications)
Species: Hu, Pm
Applications: WB, IHC, IHC-P
TBC1D9 Antibody
NBP2-13415
Immunocytochemistry/Immunofluorescence: TBC1D9 Antibody [NBP2-13415] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: TBC1D9 Antibody [NBP2-13415] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Glucosylceramidase/GBA
H00002629-M01
Western Blot: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - GBA monoclonal antibody (M01), clone 2E2 Analysis of GBA expression in MCF-7.
Immunocytochemistry/Immunofluorescence: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of monoclonal antibody to GBA on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of monoclonal antibody to GBA on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml.
(1 Review)
(6 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
p63/TP73L Antibody
- Azide and BSA Free
NBP2-33090
p63/TP73L Antibody - Azide and BSA Free
(1 Publication)
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
GR/NR3C1 Antibody
(BuGR2)
NB300-731
Western Blot: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of glucocorticoid receptor on mouse liver extract.
Immunocytochemistry/Immunofluorescence: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of Glucocorticoid Receptor using Glucocorticoid Receptor Monoclonal Antibody (BuGR2) shows staining in U251 Cells. Glucocorticoid Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucocorticoid Receptor at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on HeLa cells with GR/NR3C1 (BuGR2) antibody NB300-731AF647 (blue) and a matched isotype control NB600-986AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(2 Reviews)
(7 Publications)
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Western blot analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Immunofluorescence analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: c-jun Antibody (5B1) [NBP2-37576] - Immunohistochemical analysis of paraffin-embedded human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
SMPD1 Antibody
(OTI3H7)
NBP2-45889
Western Blot: SMPD1 Antibody (3H7) [NBP2-45889] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SMPD1.
Immunohistochemistry: SMPD1 Antibody (3H7) [NBP2-45889] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: SMPD1 Antibody (3H7) [NBP2-45889] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu
Applications: WB, IHC
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
ZNF198 Antibody
NB100-56490
Western Blot: ZNF198 Antibody [NB100-56490] - Western blot analysis of ZNF198 in mouse skeletal muscle lysate in the 1) absence and 2) presence of immunizing peptide using NB100-56490 at 0.1 ug/ml.
Immunohistochemistry-Paraffin: ZNF198 Antibody [NB100-56490] - analysis of human breast using this antibody at 10 ug/ml.
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
Nrf2 Antibody
NBP1-32822
Western Blot: Nrf2 Antibody [NBP1-32822] - Non-transfected (-) and NRF2-transfected (+, including 3xFlag-tag) 293T whole cell extracts (30ug) were separated by 5% SDS-PAGE, and the membrane was blotted with NRF2 antibody diluted by 1:1000.
Immunocytochemistry/Immunofluorescence: Nrf2 Antibody [NBP1-32822] - NIH/3T3 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: NRF2 protein stained by NRF2 antibody [N2C2], Internal diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: Nrf2 Antibody [NBP1-32822] - Paraffin-embedded Cal27 xenograft, using Nrf2 antibody at 1:500 dilution.
(3 Reviews)
(4 Publications)
Species: Hu, Mu, Rt, Av, Ce
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Glutathione
Synthetase Antibody
NBP2-30465
Western Blot: Glutathione Synthetase Antibody [NBP2-30465] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: Glutathione Synthetase Antibody [NBP2-30465] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody [NBP2-30465] - Staining in human epididymis and pancreas tissues using anti-GSS antibody. Corresponding GSS RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
UGCG Antibody
H00007357-A01
UGCG Antibody
Species: Hu
Applications: WB, ELISA

Publications for UGCG Antibody (H00007357-A01) (0)

There are no publications for UGCG Antibody (H00007357-A01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGCG Antibody (H00007357-A01) (0)

There are no reviews for UGCG Antibody (H00007357-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGCG Antibody (H00007357-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

UGCG Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional UGCG Products

Bioinformatics Tool for UGCG Antibody (H00007357-A01)

Discover related pathways, diseases and genes to UGCG Antibody (H00007357-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGCG Antibody (H00007357-A01)

Discover more about diseases related to UGCG Antibody (H00007357-A01).
 

Pathways for UGCG Antibody (H00007357-A01)

View related products by pathway.

PTMs for UGCG Antibody (H00007357-A01)

Learn more about PTMs related to UGCG Antibody (H00007357-A01).

Blogs on UGCG

There are no specific blogs for UGCG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGCG Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol UGCG