UEVLD Antibody

Images

 
Western Blot: UEVLD Antibody [NBP1-56538] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UEVLD Antibody Summary

Immunogen
Synthetic peptides corresponding to UEVLD(UEV and lactate/malate dehyrogenase domains) The peptide sequence was selected from the N terminal of UEVLD. Peptide sequence FKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UEVLD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against UEVLD and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UEVLD Antibody

  • Attp
  • EV and lactate/malate dehydrogenase domain-containing protein
  • signaling molecule ATTP
  • ubiquitin-conjugating enzyme E2 variant 3
  • UEV and lactate/malate dehyrogenase domains
  • UEV-3
  • UEV3FLJ11068

Background

UEVLD is a possible negative regulator of polyubiquitination.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14870
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBL1-16214
Species: Hu
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF4245
Species: Hu
Applications: WB, IP
MAB8634
Species: Mu
Applications: WB, Simple Western, Flow, IHC
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-56538
Species: Hu
Applications: WB

Publications for UEVLD Antibody (NBP1-56538) (0)

There are no publications for UEVLD Antibody (NBP1-56538).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UEVLD Antibody (NBP1-56538) (0)

There are no reviews for UEVLD Antibody (NBP1-56538). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UEVLD Antibody (NBP1-56538) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UEVLD Products

Bioinformatics Tool for UEVLD Antibody (NBP1-56538)

Discover related pathways, diseases and genes to UEVLD Antibody (NBP1-56538). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UEVLD

There are no specific blogs for UEVLD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UEVLD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UEVLD
Uniprot