Novus Biologicals products are now on bio-techne.com

UEV2 Antibody - BSA Free

Images

 
Western Blot: UEV2 Antibody [NBP2-95241] - Analysis of extracts of various cell lines, using UEV2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per ...read more
Immunohistochemistry-Paraffin: UEV2 Antibody [NBP2-95241] - Paraffin-embedded rat spleen using UEV2 .

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

UEV2 Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human UBE2V2 (NP_003341.1). MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBE2V2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000
Theoretical MW
16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for UEV2 Antibody - BSA Free

  • 1 alpha
  • 25-dihydroxyvitamin D3-inducible
  • DDVIT1
  • DDVit-1
  • EDAF-1
  • EDPF1
  • EDPF-1DDVit 1
  • enterocyte differentiation promoting factor
  • Enterocyte differentiation-associated factor 1
  • enterocyte differentiation-associated factor EDAF-1
  • Enterocyte differentiation-promoting factor 1
  • methyl methanesulfonate sensitive 2, S. cerevisiae, homolog of
  • MMS2
  • MMS2MMS2 homolog
  • UBE2V2
  • ubiquitin-conjugating enzyme E2 variant 2
  • Uev2
  • UEV-2
  • Vitamin D3-inducible protein

Background

The differentiation and activation of monocytes (MO) and monocytic cells is modulated by Vitamin D3. Recently, using mRNA Differential Display technology, Fritsche J, et al have identified a gene which is induced in freshly isolated human blood MO that are cultured for 4 hours with Vitamin D3. This cDNA encodes a putative 16.5 kD protein. The product of this gene has structural homology with yeast MMS2P and human CROC-1, which defines a structurally and functionally conserved UBC-like protein family. This protein was called UEV2. The yeast UEV protein is required together with UBC13 for RAD6/RAD18-dependent postreplicative DNA repair in yeast. These proteins also play a central role in the assembly of K63-linked polyubiquitin chains UEV/UBC complexes have been implicated in the assembly of Lys63-linked polyubiquitin chains that act as a novel signal in postreplicative DNA repair and IkBa kinase activation. Recent crystal structure analysis provides direct evidence that the UEV2 heterodimer is necessary for DNA repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76593
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-57183
Species: Hu
Applications: ICC/IF, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00056852-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-94633
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-130
Species: Bv, Ce, Ch, Dr, Eq, Hu, Pm, Mu, Pl, Po, Rt, Ze
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, WB
U-100H
Species: Hu
Applications: EnzAct
H00005980-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
AF2880
Species: Hu, Mu
Applications: WB
NBP2-02965
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB

Publications for UEV2 Antibody (NBP2-95241) (0)

There are no publications for UEV2 Antibody (NBP2-95241).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UEV2 Antibody (NBP2-95241) (0)

There are no reviews for UEV2 Antibody (NBP2-95241). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UEV2 Antibody (NBP2-95241) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UEV2 Products

Research Areas for UEV2 Antibody (NBP2-95241)

Find related products by research area.

Blogs on UEV2

There are no specific blogs for UEV2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UEV2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2V2